StarFunc result for job id Q9UPN4

User Input

>input (1083 residues)
MKGTRAIGSVPERSPAGVDLSLTGLPPPVSRRPGSAATTKPIVRSVSVVTGSEQKRKVLE
ATGPGGSQAINNLRRSNSTTQVSQPRSGSPRPTEPTDFLMLFEGSPSGKKRPASLSTAPS
EKGATWNVLDDQPRGFTLPSNARSSSALDSPAGPRRKECTVALAPNFTANNRSNKGAVGN
CVTTMVHNRYTPSERAPPLKSSNQTAPSLNNIIKAATCEGSESSGFGKLPKNVSSATHSA
RNNTGGSTGLPRRKEVTEEEAERFIHQVNQATVTIQRWYRHQVQRRGAGAARLEHLLQAK
REEQRQRSGEGTLLDLHQQKEAARRKAREEKARQARRAAIQELQQKRALRAQKASTAERG
PPENPRETRVPGMRQPAQELSPTPGGTAHQALKANNTGGGLPAAGPGDRCLPTSDSSPEP
QQPPEDRTQDVLAQDAAGDNLEMMAPSRGSAKSRGPLEELLHTLQLLEKEPDVLPRPRTH
HRGRYAWASEVTTEDDASSLTADNLEKFGKLSAFPEPPEDGTLLSEAKLQSIMSFLDEME
KSGQDQLDSQQEGWVPEAGPGPLELGSEVSTSVMRLKLEVEEKKQAMLLLQRALAQQRDL
TARRVKETEKALSRQLQRQREHYEATIQRHLAFIDQLIEDKKVLSEKCEAVVAELKQEDQ
RCTERVAQAQAQHELEIKKLKELMSATEKARREKWISEKTKKIKEVTVRGLEPEIQKLIA
RHKQEVRRLKSLHEAELLQSDERASQRCLRQAEELREQLEREKEALGQQERERARQRFQQ
HLEQEQWALQQQRQRLYSEVAEERERLGQQAARQRAELEELRQQLEESSSALTRALRAEF
EKGREEQERRHQMELNTLKQQLELERQAWEAGRTRKEEAWLLNREQELREEIRKGRDKEI
ELVIHRLEADMALAKEESEKAAESRIKRLRDKYEAELSELEQSERKLQERCSELKGQLGE
AEGENLRLQGLVRQKERALEDAQAVNEQLSSERSNLAQVIRQEFEDRLAASEEETRQAKA
ELATLQARQQLELEEVHRRVKTALARKEEAVSSLRTQHEAAVKRADHLEELLEQHRRPTP
STK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:I3L2J8	0.197	0.204	0.000	1047	0.966	0.999	I3L2J8.pdb.gz	I3L2J8_HUMAN Centrosomal protein 131 OS=Homo sapiens OX=9606 GN=CEP131 PE=1 SV=1
2	AFDB:Q9UPN4	1.000	1.000	0.000	1083	1.000	1.000	Q9UPN4.pdb.gz	CP131_HUMAN Centrosomal protein of 131 kDa OS=Homo sapiens OX=9606 GN=CEP131 PE=1 SV=3
3	AFDB:Q62036	0.238	0.242	2.231E-102	1060	0.730	0.746	Q62036.pdb.gz	CP131_MOUSE Centrosomal protein of 131 kDa OS=Mus musculus OX=10090 GN=Cep131 PE=1 SV=2
4	AFDB:U3JAG9	0.253	0.247	3.646E-73	1113	0.522	0.508	U3JAG9.pdb.gz	CP131_DANRE Centrosomal protein of 131 kDa OS=Danio rerio OX=7955 GN=cep131 PE=1 SV=1
5	AFDB:A1Z7Z9	0.197	0.190	1.968E-20	1134	0.216	0.206	A1Z7Z9.pdb.gz	CP131_DROME Centrosomal protein of 131 kDa OS=Drosophila melanogaster OX=7227 GN=dila PE=2 SV=2
6	AFDB:Q0VF96	0.109	0.093	7.546E-10	1302	0.204	0.170	Q0VF96.pdb.gz	CGNL1_HUMAN Cingulin-like protein 1 OS=Homo sapiens OX=9606 GN=CGNL1 PE=1 SV=2
7	AFDB:Q9PTD7	0.098	0.081	1.433E-9	1360	0.178	0.142	Q9PTD7.pdb.gz	CING_XENLA Cingulin OS=Xenopus laevis OX=8355 GN=cgn PE=1 SV=3
8	AFDB:P55937	0.077	0.058	3.138E-9	1487	0.157	0.114	P55937.pdb.gz	GOGA3_MOUSE Golgin subfamily A member 3 OS=Mus musculus OX=10090 GN=Golga3 PE=1 SV=3
9	AFDB:Q96R06	0.083	0.076	5.168E-9	1193	0.154	0.140	Q96R06.pdb.gz	SPAG5_HUMAN Sperm-associated antigen 5 OS=Homo sapiens OX=9606 GN=SPAG5 PE=1 SV=2
10	AFDB:E7F5E1	0.071	0.057	1.054E-8	1367	0.175	0.139	E7F5E1.pdb.gz	CE162_DANRE Centrosomal protein of 162 kDa OS=Danio rerio OX=7955 GN=cep162 PE=2 SV=1
11	PDB:6qdvO	0.051	0.103	2.418E-1	441	0.046	0.113	6qdvO.pdb.gz	A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
12	PDB:6j6gc	0.061	0.139	7.561E-1	436	0.039	0.096	6j6gc.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
13	PDB:7w5a2	0.033	0.266	1.005	123	0.018	0.154	7w5a2.pdb.gz	Mechanism of exon ligation by human spliceosome.
14	PDB:7oopV	0.022	0.086	1.542	217	0.018	0.088	7oopV.pdb.gz	Structural basis of human transcription-DNA repair coupling.
15	PDB:6v92R	0.048	0.131	1.909	325	0.040	0.132	6v92R.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
16	PDB:6hivAb	0.027	0.050	2.727	453	0.021	0.051	6hivAb.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
17	PDB:6id0L	0.036	0.069	3.144	475	0.040	0.091	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
18	PDB:5mqfL	0.070	0.195	3.376	336	0.024	0.077	5mqfL.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
19	PDB:6iczL	0.036	0.072	3.626	454	0.046	0.110	6iczL.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
20	PDB:7dcoL	0.061	0.139	3.626	435	0.033	0.083	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	I3L2J8	0.0	1995	1047	0.963	0.996	I3L2J8_HUMAN Centrosomal protein 131 OS=Homo sapiens OX=9606 GN=CEP131 PE=1 SV=1
2	Q62036	0.0	1431	1060	0.732	0.748	CP131_MOUSE Centrosomal protein of 131 kDa OS=Mus musculus OX=10090 GN=Cep131 PE=1 SV=2
3	Q9UPN4	0.0	2162	1083	1.000	1.000	CP131_HUMAN Centrosomal protein of 131 kDa OS=Homo sapiens OX=9606 GN=CEP131 PE=1 SV=3
4	U3JAG9	0.0	927	1113	0.516	0.502	CP131_DANRE Centrosomal protein of 131 kDa OS=Danio rerio OX=7955 GN=cep131 PE=1 SV=1
5	A1Z7Z9	6.78e-53	204	1134	0.158	0.151	CP131_DROME Centrosomal protein of 131 kDa OS=Drosophila melanogaster OX=7227 GN=dila PE=2 SV=2
6	Q38D27	1.18e-10	68.2	660	0.052	0.085	Q38D27_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4830 PE=4 SV=1
7	E7FFM2	2.92e-05	50.8	1622	0.047	0.031	E7FFM2_DANRE RB1-inducible coiled-coil 1 OS=Danio rerio OX=7955 GN=rb1cc1 PE=1 SV=2
8	D3ZUD5	1.71e-04	48.1	1027	0.099	0.104	D3ZUD5_RAT OFD1, centriole and centriolar satellite protein OS=Rattus norvegicus OX=10116 GN=Ofd1 PE=1 SV=2
9	A0A8I6AA62	1.80e-04	48.1	1036	0.099	0.103	A0A8I6AA62_RAT OFD1, centriole and centriolar satellite protein OS=Rattus norvegicus OX=10116 GN=Ofd1 PE=4 SV=1
10	Q80Z25	0.001	45.4	1017	0.094	0.100	OFD1_MOUSE Centriole and centriolar satellite protein OFD1 OS=Mus musculus OX=10090 GN=Ofd1 PE=1 SV=1
11	A0A8I3Q5R3	0.003	44.3	1181	0.076	0.069	A0A8I3Q5R3_CANLF LisH domain-containing protein OS=Canis lupus familiaris OX=9615 GN=OFD1 PE=1 SV=1
12	G3I183	0.010	42.4	957	0.071	0.080	G3I183_CRIGR Oral-facial-digital syndrome 1 protein-like OS=Cricetulus griseus OX=10029 GN=I79_017133 PE=1 SV=1
13	E9PV66	0.048	40.4	2605	0.050	0.021	E9PV66_MOUSE Myosin XVIIIb OS=Mus musculus OX=10090 GN=Myo18b PE=1 SV=1
14	Q99PL5	0.051	40.4	1605	0.059	0.040	RRBP1_MOUSE Ribosome-binding protein 1 OS=Mus musculus OX=10090 GN=Rrbp1 PE=1 SV=2
15	F1M853	0.053	40.0	1453	0.058	0.043	F1M853_RAT Ribosome binding protein 1 OS=Rattus norvegicus OX=10116 GN=Rrbp1 PE=1 SV=3
16	F4IIV5	0.20	38.1	1297	0.067	0.056	F4IIV5_ARATH Maternal effect embryo arrest 22 OS=Arabidopsis thaliana OX=3702 GN=MEE22 PE=1 SV=1
17	P85120	0.22	38.1	2058	0.081	0.043	DAPLE_XENLA Protein Daple OS=Xenopus laevis OX=8355 GN=ccdc88c PE=1 SV=1
18	A9CQL4	0.28	37.7	728	0.069	0.103	A9CQL4_CHLRE Centriole protein OS=Chlamydomonas reinhardtii OX=3055 GN=CrSAS-6 PE=1 SV=1
19	Q7TSG1	0.32	37.7	988	0.072	0.079	CE120_MOUSE Centrosomal protein of 120 kDa OS=Mus musculus OX=10090 GN=Cep120 PE=1 SV=1
20	Q9VTN6	0.33	37.4	928	0.100	0.116	Q9VTN6_DROME Twitchy OS=Drosophila melanogaster OX=7227 GN=twy PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00612 IQ	2.2e+02	13.1	IQ calmodulin-binding motif
2	PF02320 UCR_hinge	6.3e+02	12.0	Ubiquinol-cytochrome C reductase hinge protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000393583

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000327077	0.890	Pericentriolar material 1 protein
2	9606.ENSP00000344314	0.859	Oral-facial-digital syndrome 1 protein
3	9606.ENSP00000448012	0.827	Centrosomal protein of 290 kDa
4	9606.ENSP00000309836	0.727	Coiled-coil domain-containing protein 13
5	9606.ENSP00000352572	0.726	Pericentrin
6	9606.ENSP00000412365	0.694	Cyclin-dependent kinase-like 2
7	9606.ENSP00000317144	0.648	Progesterone-induced-blocking factor 1
8	9606.ENSP00000420180	0.648	Coiled-coil domain-containing protein 14
9	9606.ENSP00000164640	0.634	PDZ domain containing 4
10	9606.ENSP00000380713	0.632	Ras association domain-containing protein 7
11	9606.ENSP00000325313	0.631	Microtubule-associated protein 1S
12	9606.ENSP00000268057	0.630	Bardet-Biedl syndrome 4 protein
13	9606.ENSP00000361467	0.628	Disks large homolog 5
14	9606.ENSP00000340279	0.615	Afadin- and alpha-actinin-binding protein
15	9606.ENSP00000370337	0.601	Centrosomal protein of 152 kDa
16	9606.ENSP00000355250	0.599	Protein moonraker
17	9606.ENSP00000316357	0.596	Probable ubiquitin carboxyl-terminal hydrolase FAF-X
18	9606.ENSP00000336524	0.595	Centrosomal protein of 63 kDa
19	9606.ENSP00000453403	0.592	Nucleolar and spindle-associated protein 1
20	9606.ENSP00000264935	0.589	Centrosomal protein of 72 kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0042802	0.997	identical protein binding
GO:0046983	0.995	protein dimerization activity
GO:0042803	0.993	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0033036	0.978	macromolecule localization
GO:0016043	0.978	cellular component organization
GO:0006996	0.974	organelle organization
GO:0008104	0.972	protein localization
GO:0022607	0.961	cellular component assembly
GO:0007017	0.955	microtubule-based process
GO:0060271	0.948	cilium assembly
GO:0070201	0.944	regulation of establishment of protein localization
GO:0051649	0.935	establishment of localization in cell
GO:0031503	0.919	protein-containing complex localization
GO:0010970	0.918	transport along microtubule
GO:0042073	0.897	intraciliary transport
GO:0048522	0.878	positive regulation of cellular process
GO:0033157	0.849	regulation of intracellular protein transport
GO:0051128	0.828	regulation of cellular component organization
GO:0032501	0.795	multicellular organismal process
GO:0007010	0.654	cytoskeleton organization
GO:0000226	0.603	microtubule cytoskeleton organization
GO:0033365	0.488	protein localization to organelle
GO:0010564	0.484	regulation of cell cycle process
GO:0044380	0.406	protein localization to cytoskeleton
GO:0032886	0.404	regulation of microtubule-based process
GO:1904951	0.308	positive regulation of establishment of protein localization
GO:0010824	0.307	regulation of centrosome duplication
GO:0072698	0.302	protein localization to microtubule cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0034451	1.000	centriolar satellite
GO:0005829	0.998	cytosol
GO:0005929	0.981	cilium
GO:0045171	0.974	intercellular bridge
GO:0036064	0.936	ciliary basal body
GO:0035869	0.802	ciliary transition zone
GO:0005634	0.505	nucleus
GO:0031981	0.420	nuclear lumen
GO:0005654	0.391	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]