StarFunc result for job id Q9UPN6

User Input

>input (1271 residues)
MEAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKV
PGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKN
NVFKSEIIQPLLDMAAGIPPPVVTPVLASTTTAMSNTPGTPVTPVTPANVVQGLPDPWVS
QITNTDTLAAVAQILQSPQGQQLQQLIQTLQIQQQKPQPSILQALDAGLVVQLQALTAQL
TAAAAAANTLTPLEQGVSFNKKLMDRFDFGEDSEHSEEPKKEIPASQLSHVSESVNNSIF
HQIAEQLQQQNLEHLRQQLLEQQQPQKATPQDSQEGTFGSEHSASPSQGSSQQHFLEPEV
NLDDSIDIQQQDMDIDEGQDGVEEEVFEQEAKKVAVRSRSRTHSRSRSRSPRKRRSRSRS
GSRKRKHRKRSRSRSRERKRKSSRSYSSERRAREREKERQKKGLPPIRSKTLSVCSTTLW
VGQVDKKATQQDLTNLFEEFGQIESINMIPPRGCAYVCMVHRQDAFRALQKLSSGSYKIG
SKVIKIAWALNKGVKTEYKQFWDVDLGVTYIPWEKVKVDDLEGFAEGGMIDQETVNTEWE
TVKSSEPVKETVQTTQSPTPVEKETVVTTQAEVFPPPVAMLQIPVAPAVPTVSLVPPAFP
VSMPVPPPGFSPIPPPPFLRASFNPSQPPPGFMPPPVPPPVVPPPTIPPVVPTSLVQPSL
SMTPETVKDVGFGSLVIPGGSVASNLATSALPAGNVFNAPTKQAEPEEKVPHLIDHQISS
GENTRSVIPNDISSNAAILGGQPPNVTSNSGILGVQRPNVSSNSEILGVRPSNVSSSSGI
IAAQPPNILNNSGILGIQPPSVSNSSGLLGVLPPNIPNNSGLVGVQPPNVPNTPGLLGTQ
PPAGPQNLPPLSIPNQRMPTMPMLDIRPGLIPQAPGPRFPLIQPGIPPQRGIPPPSVLDS
ALHPPPRGPFPPGDIFSQPERPFLAPGRQSVDNVTNPEKRIPLGNDNIQQEGDRDYRFPP
IETRESISRPPPVDVRDVVGRPIDPREGPGRPPLDGRDHFGRPPVDIRENLVRPGIDHLG
RRDHFGFNPEKPWGHRGDFDEREHRVLPVYGGPKGLHEERGRFRSGNYRFDPRSGPWNRG
FGQEVHRDFDDRRRPWERQRDRDDRDFDFCREMNGNRLGRDRIQNTWVPPPHARVFDYFE
GATSQRKGDNVPQVNGENTERHAQPPPIPVQNDPELYEKLTSSNEINKEKSDTVADIESE
PVVESTETEGT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UPN6	0.999	0.999	0.000	1271	1.000	1.000	Q9UPN6.pdb.gz	SCAF8_HUMAN SR-related and CTD-associated factor 8 OS=Homo sapiens OX=9606 GN=SCAF8 PE=1 SV=1
2	AFDB:O95104	0.144	0.157	2.158E-56	1147	0.352	0.391	O95104.pdb.gz	SCAF4_HUMAN SR-related and CTD-associated factor 4 OS=Homo sapiens OX=9606 GN=SCAF4 PE=1 SV=3
3	AFDB:Q63627	0.143	0.151	4.024E-53	1200	0.371	0.393	Q63627.pdb.gz	SCAF4_RAT SR-related and CTD-associated factor 4 OS=Rattus norvegicus OX=10116 GN=Scaf4 PE=1 SV=2
4	AFDB:A8DYK5	0.133	0.129	3.345E-44	1306	0.296	0.288	A8DYK5.pdb.gz	A8DYK5_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Isha PE=1 SV=1
5	AFDB:F1QGD0	0.098	0.086	5.087E-8	1457	0.163	0.142	F1QGD0.pdb.gz
6	AFDB:O94913	0.098	0.082	5.958E-8	1555	0.168	0.138	O94913.pdb.gz	PCF11_HUMAN Pre-mRNA cleavage complex 2 protein Pcf11 OS=Homo sapiens OX=9606 GN=PCF11 PE=1 SV=3
7	AFDB:Q9R0I7	0.053	0.049	5.905E-5	1386	0.172	0.158	Q9R0I7.pdb.gz	YLPM1_MOUSE YLP motif-containing protein 1 OS=Mus musculus OX=10090 GN=Ylpm1 PE=2 SV=2
8	PDB:6id0O	0.059	0.239	1.069E-4	290	0.021	0.093	6id0O.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
9	PDB:3lqvB	0.057	0.556	1.252E-4	115	0.014	0.157	3lqvB.pdb.gz	Branch Recognition by SF3b14
10	PDB:5oobB	0.053	0.408	1.717E-4	152	0.018	0.151	5oobB.pdb.gz	Structural basis for mutually exclusive co-transcriptional nuclear cap-binding complexes with either NELF-E or ARS2.
11	PDB:6qx91K	0.053	0.329	1.810E-4	201	0.025	0.159	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
12	AFDB:Q14966	0.066	0.047	2.090E-4	1978	0.121	0.078	Q14966.pdb.gz	ZN638_HUMAN Zinc finger protein 638 OS=Homo sapiens OX=9606 GN=ZNF638 PE=1 SV=2
13	PDB:6n7pY	0.055	0.477	2.759E-4	138	0.019	0.174	6n7pY.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
14	PDB:6ff7X	0.055	0.377	4.671E-4	171	0.014	0.105	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
15	AFDB:Q5VT52	0.110	0.096	7.397E-4	1461	0.157	0.136	Q5VT52.pdb.gz	RPRD2_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPRD2 PE=1 SV=1
16	PDB:7oqcF	0.063	0.281	8.788E-4	267	0.014	0.067	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
17	AFDB:Q9VWE6	0.046	0.032	1.127E-3	2111	0.128	0.077	Q9VWE6.pdb.gz	ELYS_DROME Protein ELYS homolog OS=Drosophila melanogaster OX=7227 GN=Elys PE=1 SV=2
18	PDB:5yzg1	0.055	0.272	1.271E-3	243	0.014	0.074	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
19	PDB:6exnY	0.054	0.708	2.268E-3	87	0.017	0.241	6exnY.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
20	PDB:6gd1A	0.056	0.358	2.390E-3	190	0.012	0.079	6gd1A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MT33	0.0	2567	1349	1.000	0.942	A0A0A0MT33_HUMAN SR-related CTD associated factor 8 OS=Homo sapiens OX=9606 GN=SCAF8 PE=1 SV=1
2	Q63623	0.0	1912	1268	0.915	0.917	SCAF8_RAT SR-related and CTD-associated factor 8 OS=Rattus norvegicus OX=10116 GN=Scaf8 PE=1 SV=1
3	Q9UPN6	0.0	2568	1271	1.000	1.000	SCAF8_HUMAN SR-related and CTD-associated factor 8 OS=Homo sapiens OX=9606 GN=SCAF8 PE=1 SV=1
4	O95104	1.83e-77	281	1147	0.131	0.145	SCAF4_HUMAN SR-related and CTD-associated factor 4 OS=Homo sapiens OX=9606 GN=SCAF4 PE=1 SV=3
5	Q63627	2.19e-77	282	1200	0.129	0.137	SCAF4_RAT SR-related and CTD-associated factor 4 OS=Rattus norvegicus OX=10116 GN=Scaf4 PE=1 SV=2
6	A8DYK5	2.12e-57	220	1306	0.078	0.076	A8DYK5_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Isha PE=1 SV=1
7	Q9SX79	1.62e-08	60.8	432	0.026	0.076	RB47C_ARATH Polyadenylate-binding protein RBP47C OS=Arabidopsis thaliana OX=3702 GN=RBP47C PE=2 SV=1
8	Q9SX80	2.58e-08	60.1	434	0.027	0.078	R47CP_ARATH Polyadenylate-binding protein RBP47C' OS=Arabidopsis thaliana OX=3702 GN=RBP47C' PE=2 SV=1
9	O60176	3.04e-07	57.0	473	0.020	0.053	YG41_SCHPO Uncharacterized RNA-binding protein C23E6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC23E6.01c PE=1 SV=2
10	Q9LEB3	1.03e-06	55.1	428	0.022	0.065	RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia OX=4092 GN=RBP47 PE=1 SV=1
11	Q9UTE3	3.03e-06	53.9	620	0.028	0.058	SEB1_SCHPO Rpb7-binding protein seb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=seb1 PE=1 SV=3
12	Q8LPQ9	3.41e-06	53.9	901	0.021	0.030	FPA_ARATH Flowering time control protein FPA OS=Arabidopsis thaliana OX=3702 GN=FPA PE=1 SV=2
13	Q5ARJ0	8.39e-06	52.0	393	0.017	0.056	Q5ARJ0_EMENI RRM domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_09090 PE=4 SV=1
14	Q9LNV5	9.13e-06	52.4	481	0.019	0.050	C3H4_ARATH Zinc finger CCCH domain-containing protein 4 OS=Arabidopsis thaliana OX=3702 GN=At1g07360 PE=1 SV=1
15	F4I3B3	2.28e-05	50.8	445	0.020	0.056	RB47A_ARATH Polyadenylate-binding protein RBP47A OS=Arabidopsis thaliana OX=3702 GN=RBP47A PE=2 SV=1
16	Q9ZW36	2.98e-05	50.4	483	0.017	0.046	C3H25_ARATH Zinc finger CCCH domain-containing protein 25 OS=Arabidopsis thaliana OX=3702 GN=At2g29580 PE=1 SV=1
17	Q93W34	5.92e-05	49.3	415	0.017	0.053	RP45C_ARATH Polyadenylate-binding protein RBP45C OS=Arabidopsis thaliana OX=3702 GN=RBP45C PE=2 SV=1
18	A0A0R4IJ04	7.38e-05	49.3	556	0.022	0.050	A0A0R4IJ04_DANRE RNA binding motif protein 14 isoform X3 OS=Danio rerio OX=7955 GN=rbm14 PE=1 SV=2
19	Q6NV05	7.51e-05	49.3	556	0.022	0.050	Q6NV05_DANRE RNA binding motif protein 14 OS=Danio rerio OX=7955 GN=zgc:85696 PE=1 SV=1
20	P39081	1.63e-04	48.5	626	0.028	0.056	PCF11_YEAST Protein PCF11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PCF11 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04818 CID	1.4e-21	88.4	CID domain
2	PF12039 DUF3525	67	13.7	Protein of unknown function (DUF3525)
3	PF00076 RRM_1	8.6e-06	36.8	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
4	PF16842 RRM_occluded	2e+02	13.3	Occluded RNA-recognition motif
5	PF06495 Transformer	0.66	21.6	Fruit fly transformer protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010355852.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010371134.1	0.961	Senataxin
2	61622.XP_010362652.1	0.850	Cell division cycle 42
3	61622.XP_010363532.1	0.833	Helicase with zinc finger domain 2
4	61622.XP_010366637.1	0.821	Ras homolog family member F, filopodia associated
5	61622.XP_010376404.1	0.819	Ras homolog family member J
6	61622.XP_010368074.1	0.816	Ras homolog family member A
7	61622.XP_010366046.1	0.812	Ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
8	61622.XP_010377988.1	0.812	Cleavage and polyadenylation specific factor 3
9	61622.XP_010373524.1	0.809	Cleavage and polyadenylation specificity factor subunit 1
10	61622.XP_010360655.1	0.794	DNA-directed RNA polymerase II subunit RPB1
11	61622.XP_010379494.1	0.794	UBX domain-containing protein 7
12	61622.XP_010387500.1	0.788	Ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
13	61622.XP_010381310.1	0.785	Ras homolog family member B
14	61622.XP_010352637.1	0.781	Ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3)
15	61622.XP_010382796.1	0.781	Cleavage and polyadenylation specificity factor subunit 2
16	61622.XP_010357352.1	0.762	Rho-related GTP-binding protein RhoC
17	61622.XP_010357355.1	0.762	Ras homolog family member C
18	61622.XP_010371501.1	0.762	KRAS proto-oncogene, GTPase
19	61622.XP_010362660.1	0.758	EPH receptor B2
20	61622.XP_010365050.1	0.758	Belongs to the PI3/PI4-kinase family

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050815	1.000	phosphoserine residue binding
GO:0003723	1.000	RNA binding
GO:0000993	0.999	RNA polymerase II complex binding
GO:0099122	0.973	RNA polymerase II C-terminal domain binding
GO:1990269	0.957	RNA polymerase II C-terminal domain phosphoserine binding
GO:0019904	0.764	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.977	regulation of cellular process
GO:0019222	0.975	regulation of metabolic process
GO:0060255	0.974	regulation of macromolecule metabolic process
GO:0080090	0.970	regulation of primary metabolic process
GO:0051171	0.970	regulation of nitrogen compound metabolic process
GO:0071704	0.969	organic substance metabolic process
GO:0044238	0.967	primary metabolic process
GO:0044237	0.967	cellular metabolic process
GO:0031323	0.967	regulation of cellular metabolic process
GO:0019219	0.964	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.960	regulation of gene expression
GO:0006807	0.959	nitrogen compound metabolic process
GO:0051252	0.949	regulation of RNA metabolic process
GO:0043170	0.945	macromolecule metabolic process
GO:0010556	0.944	regulation of macromolecule biosynthetic process
GO:0031326	0.944	regulation of cellular biosynthetic process
GO:0048519	0.936	negative regulation of biological process
GO:0048523	0.925	negative regulation of cellular process
GO:0090304	0.921	nucleic acid metabolic process
GO:0006355	0.916	regulation of DNA-templated transcription
GO:0010605	0.905	negative regulation of macromolecule metabolic process
GO:0010604	0.886	positive regulation of macromolecule metabolic process
GO:0048522	0.883	positive regulation of cellular process
GO:0016070	0.855	RNA metabolic process
GO:0006366	0.852	transcription by RNA polymerase II
GO:0045935	0.847	positive regulation of nucleobase-containing compound metabolic process
GO:0016071	0.808	mRNA metabolic process
GO:0051172	0.757	negative regulation of nitrogen compound metabolic process
GO:0031324	0.749	negative regulation of cellular metabolic process
GO:0051254	0.702	positive regulation of RNA metabolic process
GO:0006396	0.688	RNA processing
GO:0045934	0.686	negative regulation of nucleobase-containing compound metabolic process
GO:0043244	0.666	regulation of protein-containing complex disassembly
GO:0006397	0.546	mRNA processing
GO:0051253	0.529	negative regulation of RNA metabolic process
GO:0031327	0.526	negative regulation of cellular biosynthetic process
GO:0006357	0.516	regulation of transcription by RNA polymerase II
GO:0010557	0.491	positive regulation of macromolecule biosynthetic process
GO:0031328	0.489	positive regulation of cellular biosynthetic process
GO:0010558	0.437	negative regulation of macromolecule biosynthetic process
GO:0051129	0.409	negative regulation of cellular component organization
GO:0045893	0.351	positive regulation of DNA-templated transcription
GO:0045892	0.344	negative regulation of DNA-templated transcription
GO:0032784	0.320	regulation of DNA-templated transcription elongation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.376	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]