StarFunc result for job id Q9UPP1

User Input

>input (1060 residues)
MNRSRAIVQRGRVLPPPAPLDTTNLAGRRTLQGRAKMASVPVYCLCRLPYDVTRFMIECD
MCQDWFHGSCVGVEEEKAADIDLYHCPNCEVLHGPSIMKKRRGSSKGHDTHKGKPVKTGS
PTFVRELRSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTV
RDVEHYVGSDKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLV
ETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEK
IFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTGWIHAVLTP
VDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFRFPNFETICWYVGKHILDIFRGLRE
NRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVEDIF
QQNVGKTSNIFGLQRIFPAGSIPLTRPAHSTSVSMSRLSLPSKNGSKKKGLKPKELFKKA
ERKGKESSALGPAGQLSYNLMDTYSHQALKTGSFQKAKFNITGACLNDSDDDSPDLDLDG
NESPLALLMSNGSTKRVKSLSKSRRTKIAKKVDKARLMAEQVMEDEFDLDSDDELQIDER
LGKEKATLIIRPKFPRKLPRAKPCSDPNRVREPGEVEFDIEEDYTTDEDMVEGVEGKLGN
GSGAGGILDLLKASRQVGGPDYAALTEAPASPSTQEAIQGMLCMANLQSSSSSPATSSLQ
AWWTGGQDRSSGSSSSGLGTVSNSPASQRTPGKRPIKRPAYWRTESEEEEENASLDEQDS
LGACFKDAEYIYPSLESDDDDPALKSRPKKKKNSDDAPWSPKARVTPTLPKQDRPVREGT
RVASIETGLAAAAAKLAQQELQKAQKKKYIKKKPLLKEVEQPRPQDSNLSLTVPAPTVAA
TPQLVTSSSPLPPPEPKQEALSGSLADHEYTARPNAFGMAQANRSTTPMAPGVFLTQRRP
SVGSQSNQAGQGKRPKKGLATAKQRLGRILKIHRNGKLLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UPP1	1.000	1.000	0.000	1060	1.000	1.000	Q9UPP1.pdb.gz	PHF8_HUMAN Histone lysine demethylase PHF8 OS=Homo sapiens OX=9606 GN=PHF8 PE=1 SV=3
2	AFDB:P0CF52	0.349	0.634	3.011E-67	577	0.272	0.499	P0CF52.pdb.gz	KDM7B_DANRE Lysine-specific demethylase 7B OS=Danio rerio OX=7955 GN=jhdm1db PE=2 SV=1
3	PDB:3al5B	0.183	0.548	1.068E-10	311	0.051	0.174	3al5B.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
4	PDB:7yxgA	0.172	0.498	9.921E-10	313	0.048	0.163	7yxgA.pdb.gz	Conservation of the unusual dimeric JmjC fold of JMJD7 from Drosophila melanogaster to humans.
5	PDB:4b7eA	0.171	0.459	5.648E-9	349	0.043	0.132	4b7eA.pdb.gz	Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
6	PDB:3al5C	0.169	0.540	6.649E-9	284	0.045	0.169	3al5C.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
7	PDB:5nfnB	0.174	0.507	9.212E-9	318	0.042	0.142	5nfnB.pdb.gz	(3S)-Lysyl hydroxylation of TRAFAC GTPases is catalyzed by the human Jumonji-C oxygenase JMJD7.
8	PDB:4qszA	0.159	0.234	1.972E-8	686	0.045	0.070	4qszA.pdb.gz	Crystal structure of mouse JMJd7 fused with maltose-binding protein
9	PDB:4bxfA	0.128	0.291	2.187E-5	425	0.030	0.075	4bxfA.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
10	PDB:4cclB	0.136	0.346	6.848E-5	372	0.032	0.091	4cclB.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
11	PDB:4bu2A	0.110	0.267	8.986E-5	379	0.040	0.111	4bu2A.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
12	PDB:2vqaA	0.075	0.204	1.179E-4	356	0.022	0.065	2vqaA.pdb.gz	Protein-Folding Location Can Regulate Manganese-Binding Versus Copper- or Zinc-Binding.
13	AFDB:Q388V9	0.035	0.035	6.559E-2	1087	0.087	0.085	Q388V9.pdb.gz	Q388V9_TRYB2 Right handed beta helix domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.0660 PE=4 SV=1
14	AFDB:Q8WZ75	0.049	0.051	1.013E-1	1007	0.107	0.112	Q8WZ75.pdb.gz	ROBO4_HUMAN Roundabout homolog 4 OS=Homo sapiens OX=9606 GN=ROBO4 PE=1 SV=1
15	AFDB:O15054	0.045	0.033	1.130E-1	1643	0.113	0.073	O15054.pdb.gz	KDM6B_HUMAN Lysine-specific demethylase 6B OS=Homo sapiens OX=9606 GN=KDM6B PE=1 SV=4
16	AFDB:Q9FWQ5	0.044	0.032	1.404E-1	1706	0.098	0.061	Q9FWQ5.pdb.gz	HAC12_ARATH Histone acetyltransferase HAC12 OS=Arabidopsis thaliana OX=3702 GN=HAC12 PE=3 SV=2
17	AFDB:Q23977	0.052	0.047	2.290E-1	1178	0.082	0.074	Q23977.pdb.gz	HEP_DROME Dual specificity mitogen-activated protein kinase kinase hemipterous OS=Drosophila melanogaster OX=7227 GN=hep PE=1 SV=2
18	AFDB:Q54EH1	0.067	0.086	2.553E-1	686	0.083	0.128	Q54EH1.pdb.gz	EPN_DICDI Epsin OS=Dictyostelium discoideum OX=44689 GN=epnA PE=3 SV=1
19	AFDB:A0A024RAW9	0.064	0.097	2.695E-1	641	0.106	0.175	A0A024RAW9.pdb.gz
20	AFDB:Q6FRV6	0.058	0.032	3.005E-1	2238	0.094	0.045	Q6FRV6.pdb.gz	SEC16_CANGA COPII coat assembly protein SEC16 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SEC16 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0Y3N9	0.0	2124	1049	0.966	0.976	H0Y3N9_HUMAN PHD finger protein 8 OS=Homo sapiens OX=9606 GN=PHF8 PE=1 SV=2
2	H0Y589	0.0	1337	659	0.609	0.980	H0Y589_HUMAN PHD finger protein 8 (Fragment) OS=Homo sapiens OX=9606 GN=PHF8 PE=1 SV=1
3	O75151	0.0	647	1096	0.267	0.258	PHF2_HUMAN Lysine-specific demethylase PHF2 OS=Homo sapiens OX=9606 GN=PHF2 PE=1 SV=4
4	P0CF52	0.0	588	577	0.258	0.473	KDM7B_DANRE Lysine-specific demethylase 7B OS=Danio rerio OX=7955 GN=jhdm1db PE=2 SV=1
5	P0CH95	0.0	1183	1032	0.623	0.640	PHF8_DANRE Histone lysine demethylase PHF8 OS=Danio rerio OX=7955 GN=phf8 PE=1 SV=1
6	Q3UWM4	0.0	634	940	0.341	0.384	KDM7A_MOUSE Lysine-specific demethylase 7A OS=Mus musculus OX=10090 GN=Kdm7a PE=1 SV=2
7	Q5RHD1	0.0	602	875	0.258	0.313	KDM7A_DANRE Lysine-specific demethylase 7A OS=Danio rerio OX=7955 GN=kdm7a PE=2 SV=2
8	Q6ZMT4	0.0	631	941	0.341	0.384	KDM7A_HUMAN Lysine-specific demethylase 7A OS=Homo sapiens OX=9606 GN=KDM7A PE=1 SV=2
9	Q9UPP1	0.0	2197	1060	1.000	1.000	PHF8_HUMAN Histone lysine demethylase PHF8 OS=Homo sapiens OX=9606 GN=PHF8 PE=1 SV=3
10	Q9WTU0	0.0	652	1096	0.269	0.260	PHF2_MOUSE Lysine-specific demethylase PHF2 OS=Mus musculus OX=10090 GN=Phf2 PE=1 SV=2
11	Q8NHM5	1.35e-85	305	1336	0.132	0.105	KDM2B_HUMAN Lysine-specific demethylase 2B OS=Homo sapiens OX=9606 GN=KDM2B PE=1 SV=1
12	Q6P1G2	3.37e-85	303	1309	0.129	0.105	KDM2B_MOUSE Lysine-specific demethylase 2B OS=Mus musculus OX=10090 GN=Kdm2b PE=1 SV=1
13	F6P9Q3	6.48e-84	299	1260	0.126	0.106	F6P9Q3_DANRE Lysine (K)-specific demethylase 2Bb OS=Danio rerio OX=7955 GN=LOC100536129 PE=4 SV=1
14	I3VM53	7.27e-83	295	1162	0.136	0.124	I3VM53_HUMAN F-box and leucine-rich repeat protein 11, isoform CRA_a OS=Homo sapiens OX=9606 GN=KDM2A PE=2 SV=1
15	Q9Y2K7	7.27e-83	295	1162	0.136	0.124	KDM2A_HUMAN Lysine-specific demethylase 2A OS=Homo sapiens OX=9606 GN=KDM2A PE=1 SV=3
16	I3VM54	8.09e-83	294	1145	0.136	0.126	I3VM54_HUMAN Lysine demethylase 2A OS=Homo sapiens OX=9606 GN=KDM2A PE=1 SV=1
17	Q9VHH9	3.33e-82	295	1345	0.128	0.101	JHD1_DROME JmjC domain-containing histone demethylation protein 1 OS=Drosophila melanogaster OX=7227 GN=Kdm2 PE=1 SV=2
18	P59997	3.77e-82	293	1161	0.135	0.123	KDM2A_MOUSE Lysine-specific demethylase 2A OS=Mus musculus OX=10090 GN=Kdm2a PE=1 SV=2
19	A0A0R4IH56	1.17e-79	286	1295	0.135	0.110	A0A0R4IH56_DANRE Lysine (K)-specific demethylase 2Aa OS=Danio rerio OX=7955 GN=jhdm1A-b PE=1 SV=1
20	Q9GYI0	1.76e-73	264	910	0.142	0.165	KDM7_CAEEL Lysine-specific demethylase 7 homolog OS=Caenorhabditis elegans OX=6239 GN=jmjd-1.2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13621 Cupin_8	0.00032	32.2	Cupin-like domain
2	PF17811 JHD	6.3e-41	150.4	Jumonji helical domain
3	PF02373 JmjC	4.4e-08	44.9	JmjC domain, hydroxylase
4	PF08007 JmjC_2	6e+02	11.4	JmjC domain
5	PF00628 PHD	5.8e-05	34.2	PHD-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350676

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000480826	0.980	Histone cluster 1 H3 family member a
2	9606.ENSP00000384629	0.958	N-lysine methyltransferase KMT5A
3	9606.ENSP00000476960	0.939	Histone cluster 2 H3 pseudogene 2
4	9606.ENSP00000378699	0.921	Cyclin-dependent kinase 1
5	9606.ENSP00000433681	0.908	Condensin-2 complex subunit D3
6	9606.ENSP00000256442	0.907	G2/mitotic-specific cyclin-B1
7	9606.ENSP00000387007	0.906	Condensin-2 complex subunit G2
8	9606.ENSP00000366999	0.874	Histone cluster 1 H3 family member d
9	9606.ENSP00000482271	0.874	Histone cluster 1 H3 family member e
10	9606.ENSP00000484658	0.874	Histone cluster 1 H3 family member c
11	9606.ENSP00000339835	0.863	Histone H3.3C
12	9606.ENSP00000352252	0.863	Histone cluster 1 H3 family member j
13	9606.ENSP00000355778	0.861	Histone H3.3
14	9606.ENSP00000254810	0.857	H3 histone, family 3B (H3.3B)
15	9606.ENSP00000385479	0.851	Histone H3.2
16	9606.ENSP00000358160	0.850	Histone cluster 1 H3 family member h
17	9606.ENSP00000483283	0.850	Histone cluster 1 H3 family member i
18	9606.ENSP00000484095	0.850	Histone cluster 1 H3 family member f
19	9606.ENSP00000484638	0.850	Histone cluster 1 H3 family member g
20	9606.ENSP00000484841	0.850	Histone H3.1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035064	1.000	methylated histone binding
GO:0032454	1.000	histone H3K9 demethylase activity
GO:0008270	1.000	zinc ion binding
GO:0005506	1.000	iron ion binding
GO:0071558	0.999	histone H3K27me2/H3K27me3 demethylase activity
GO:0003682	0.995	chromatin binding
GO:0051864	0.787	histone H3K36 demethylase activity
GO:1901363	0.710	heterocyclic compound binding
GO:0097159	0.710	organic cyclic compound binding
GO:0035575	0.687	histone H4K20 demethylase activity
GO:0003676	0.670	nucleic acid binding
GO:0003677	0.464	DNA binding
GO:0043565	0.301	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0031323	0.994	regulation of cellular metabolic process
GO:0060255	0.992	regulation of macromolecule metabolic process
GO:0048518	0.991	positive regulation of biological process
GO:0080090	0.985	regulation of primary metabolic process
GO:0051171	0.985	regulation of nitrogen compound metabolic process
GO:0009987	0.983	cellular process
GO:0019219	0.983	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.980	regulation of gene expression
GO:0048522	0.972	positive regulation of cellular process
GO:0051252	0.958	regulation of RNA metabolic process
GO:0031326	0.956	regulation of cellular biosynthetic process
GO:0006355	0.953	regulation of DNA-templated transcription
GO:0010604	0.948	positive regulation of macromolecule metabolic process
GO:0031325	0.934	positive regulation of cellular metabolic process
GO:0045935	0.921	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.911	positive regulation of DNA-templated transcription
GO:0048523	0.887	negative regulation of cellular process
GO:0006357	0.818	regulation of transcription by RNA polymerase II
GO:0071704	0.638	organic substance metabolic process
GO:0044238	0.566	primary metabolic process
GO:0043170	0.566	macromolecule metabolic process
GO:0010628	0.550	positive regulation of gene expression
GO:0006807	0.538	nitrogen compound metabolic process
GO:0043412	0.402	macromolecule modification
GO:0071840	0.386	cellular component organization or biogenesis
GO:0051128	0.377	regulation of cellular component organization
GO:0045944	0.363	positive regulation of transcription by RNA polymerase II
GO:0036211	0.355	protein modification process
GO:0016043	0.354	cellular component organization
GO:1903047	0.302	mitotic cell cycle process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0031965	0.999	nuclear membrane
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0005730	0.694	nucleolus
GO:0032991	0.423	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:60224	0.999	2 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(27)-[histone H3] + 2 O2 = 2 CO2 + 2 formaldehyde + N(6)-methyl-L-lysyl(27)-[histone H3] + 2 succinate
EC:1.14.11.68	0.999	[histone H3]-trimethyl-L-lysine(27) demethylase.

[back to server]