StarFunc result for job id Q9UPP2

User Input

>input (1182 residues)
MESLLENPVRAVLYLKELTAIVQNQQSLIHTQRERIDELERRLDELSAENRSLWEHQQLL
QAQPPPGLVPPSSAPLPAAPATAPAAAARAQEPLQDQGQRSAAAPHPAPDRPPRQHHGQL
LEQPQRGPGSRAHTPQSPHKHLGTQGAVTDKEKERPPSCCAAAGALLQHKSPSALGKGVL
SRRPENETVLHQFCCPAADACSDLASQSDGSCTQAGGGMEDSVVAAAAVAAGRPSAHAPK
AQAQELQEEEERPGAGAASPRAGPQHKASPGRQQPALATALCPHAPAASDYELSLDLKNK
QIEMLEHKYGGHLVSRRAACTIQTAFRQYQLSKNFEKIRNSLLESRLPRRISLRKVRSPT
AESLAAEKALMEGYGLVGLPLVRSPSLPPTFAGTLTELEDSFTEQVQSLAKSIDDALSTW
SLKTMCSLRESGAYQLHQALQAAAGPPGLEAEGRAPESAGPGPGDDAAETPGLPPAHSGT
LMMAFRDVTVQIANQNISVSSSTALSVANCLGAQTVQAPAEPAAGKAEQGETSGREAPEA
PAVGREDASAEDSCAEAAASGAADGATAPKTEEEEEEEETAEVGRGAEAEAGDLEQLSSS
STSTKSAKSGSEASASASKDALQAMILSLPRYHCENPASCKSPTLSTDTLRKRLYRIGLN
LFNINPDKGIQFLISRGFIPDTPIGVAHFLLQRKGLSRQMIGEFLGNSKKQFNRDVLDCV
VDEMDFSSMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCMCNPEVVQQFHNPDTIF
ILAFAIILLNTDMYSPNIKPDRKMMLEDFIRNLRGVDDGADIPRELVVGIYERIQQKELK
SNEDHVTYVTKVEKSIVGMKTVLSVPHRRLVCCSRLFEVTDVNKLQKQAAHQREVFLFND
LLVILKLCPKKKSSSTYTFCKSVGLLGMQFQLFENEYYSHGITLVTPLSGSEKKQVLHFC
ALGSDEMQKFVEDLKESIAEVTELEQIRIEWELEKQQGTKTLSFKPCGAQGDPQSKQGSP
TAKREAALRERPAESTVEVSIHNRLQTSQHNSGLGAERGAPVPPPDLQPSPPRQQTPPLP
PPPPTPPGTLVQCQQIVKVIVLDKPCLARMEPLLSQALSCYTSSSSDSCGSTPLGGPGSP
VKVTHQPPLPPPPPPYNHPHQFCPPGSLLHGHRYSSGSRSLV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3TES0	0.400	0.396	0.000	1195	0.869	0.859	Q3TES0.pdb.gz	IQEC3_MOUSE IQ motif and SEC7 domain-containing protein 3 OS=Mus musculus OX=10090 GN=Iqsec3 PE=1 SV=1
2	AFDB:Q9UPP2	1.000	1.000	0.000	1182	1.000	1.000	Q9UPP2.pdb.gz	IQEC3_HUMAN IQ motif and SEC7 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=IQSEC3 PE=2 SV=3
3	AFDB:A0A3B3IRZ4	0.334	0.323	2.274E-63	1222	0.396	0.383	A0A3B3IRZ4.pdb.gz	A0A3B3IRZ4_HUMAN IQ motif and Sec7 domain ArfGEF 1 OS=Homo sapiens OX=9606 GN=IQSEC1 PE=1 SV=1
4	PDB:6bbpA	0.170	0.360	9.940E-21	520	0.080	0.183	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
5	PDB:6u3eA	0.155	0.437	4.781E-20	397	0.084	0.249	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
6	AFDB:E1JIT7	0.154	0.119	2.954E-16	1601	0.153	0.113	E1JIT7.pdb.gz	PSD_DROME PH and SEC7 domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Efa6 PE=1 SV=2
7	AFDB:Q54YZ6	0.118	0.115	4.407E-9	1218	0.095	0.092	Q54YZ6.pdb.gz	Q54YZ6_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=gxcA PE=4 SV=1
8	AFDB:P97433	0.097	0.071	5.397E-9	1693	0.133	0.093	P97433.pdb.gz	ARG28_MOUSE Rho guanine nucleotide exchange factor 28 OS=Mus musculus OX=10090 GN=Arhgef28 PE=1 SV=2
9	AFDB:Q6ZNL6	0.107	0.089	1.020E-7	1462	0.119	0.096	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
10	AFDB:X2JC00	0.102	0.089	1.692E-7	1404	0.126	0.106	X2JC00.pdb.gz	X2JC00_DROME Rho GTPase activating protein at 1A, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
11	AFDB:Q12774	0.112	0.089	1.495E-6	1597	0.118	0.088	Q12774.pdb.gz	ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3
12	PDB:7rx9A	0.116	0.276	8.691E-6	432	0.041	0.113	7rx9A.pdb.gz
13	AFDB:P34288	0.078	0.060	2.307E-5	1605	0.135	0.099	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
14	PDB:4mt6A	0.113	0.284	2.394E-5	389	0.033	0.100	4mt6A.pdb.gz
15	PDB:4gouA	0.095	0.196	7.898E-4	507	0.041	0.095	4gouA.pdb.gz
16	PDB:3m1iB	0.082	0.516	5.698E-3	131	0.014	0.130	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
17	PDB:1k5dB	0.077	0.461	8.124E-3	146	0.016	0.130	1k5dB.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
18	PDB:6hhgA	0.076	0.222	2.022E-2	386	0.010	0.031	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
19	PDB:6xtbE	0.073	0.311	3.357E-2	235	0.009	0.047	6xtbE.pdb.gz
20	PDB:6s9wA	0.075	0.207	5.035E-2	411	0.011	0.032	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DGT3	0.0	562	814	0.234	0.340	A0A0C4DGT3_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=IQSEC1 PE=1 SV=1
2	A0A2R8Y7T6	0.0	563	964	0.235	0.288	A0A2R8Y7T6_HUMAN IQ motif and Sec7 domain ArfGEF 1 OS=Homo sapiens OX=9606 GN=IQSEC1 PE=1 SV=1
3	A0A3B3IRZ4	0.0	567	1222	0.235	0.227	A0A3B3IRZ4_HUMAN IQ motif and Sec7 domain ArfGEF 1 OS=Homo sapiens OX=9606 GN=IQSEC1 PE=1 SV=1
4	Q3TES0	0.0	1756	1195	0.850	0.841	IQEC3_MOUSE IQ motif and SEC7 domain-containing protein 3 OS=Mus musculus OX=10090 GN=Iqsec3 PE=1 SV=1
5	Q6DN90	0.0	563	963	0.235	0.289	IQEC1_HUMAN IQ motif and SEC7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=IQSEC1 PE=1 SV=1
6	Q76M68	0.0	1800	1194	0.850	0.842	IQEC3_RAT IQ motif and SEC7 domain-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Iqsec3 PE=1 SV=1
7	Q8R0S2	0.0	562	961	0.234	0.288	IQEC1_MOUSE IQ motif and SEC7 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Iqsec1 PE=1 SV=2
8	Q9UPP2	0.0	2410	1182	1.000	1.000	IQEC3_HUMAN IQ motif and SEC7 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=IQSEC3 PE=2 SV=3
9	X1WBR0	0.0	565	1134	0.234	0.243	X1WBR0_DANRE IQ motif and SEC7 domain-containing protein 1 isoform X3 OS=Danio rerio OX=7955 GN=iqsec1b PE=1 SV=2
10	E7EZE5	1.26e-180	566	1252	0.234	0.221	E7EZE5_DANRE IQ motif and SEC7 domain-containing protein 1 isoform X1 OS=Danio rerio OX=7955 GN=iqsec1b PE=1 SV=1
11	A0A8I6APH1	9.51e-168	523	949	0.205	0.255	A0A8I6APH1_RAT IQ motif and Sec7 domain ArfGEF 2 OS=Rattus norvegicus OX=10116 GN=Iqsec2 PE=3 SV=1
12	A0A0G2JZX5	9.23e-167	522	1002	0.205	0.242	A0A0G2JZX5_RAT IQ motif and Sec7 domain ArfGEF 2 OS=Rattus norvegicus OX=10116 GN=Iqsec2 PE=1 SV=2
13	A0A8I5Y7S8	2.17e-166	526	1154	0.205	0.210	A0A8I5Y7S8_RAT IQ motif and Sec7 domain ArfGEF 2 OS=Rattus norvegicus OX=10116 GN=Iqsec2 PE=3 SV=1
14	Q5DU25	1.04e-163	527	1478	0.205	0.164	IQEC2_MOUSE IQ motif and SEC7 domain-containing protein 2 OS=Mus musculus OX=10090 GN=Iqsec2 PE=1 SV=3
15	Q5JU85	1.14e-163	527	1488	0.205	0.163	IQEC2_HUMAN IQ motif and SEC7 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=IQSEC2 PE=1 SV=2
16	A0A8I6GKX8	1.29e-163	527	1488	0.205	0.163	A0A8I6GKX8_RAT IQ motif and Sec7 domain ArfGEF 2 OS=Rattus norvegicus OX=10116 GN=Iqsec2 PE=3 SV=1
17	A4GZ26	7.91e-154	500	1479	0.198	0.158	A4GZ26_MOUSE ARF6 guanine nucleotide exchange factor IQArfGEF OS=Mus musculus OX=10090 GN=Iqsec2 PE=1 SV=1
18	A0A2R8Y695	1.68e-140	446	779	0.184	0.280	A0A2R8Y695_HUMAN IQ motif and Sec7 domain ArfGEF 1 (Fragment) OS=Homo sapiens OX=9606 GN=IQSEC1 PE=1 SV=1
19	Q95U36	1.37e-126	417	1082	0.165	0.180	Q95U36_DROME GH10594p OS=Drosophila melanogaster OX=7227 GN=siz PE=2 SV=1
20	E1JI59	4.52e-126	419	1220	0.165	0.160	E1JI59_DROME Schizo, isoform D OS=Drosophila melanogaster OX=7227 GN=siz PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	3.3e+02	12.8	bZIP transcription factor
2	PF16453 IQ_SEC7_PH	9.6e-57	202.1	PH domain
3	PF19057 PH_19	38	15.4	PH domain
4	PF01369 Sec7	2.8e-56	201.6	Sec7 domain
5	PF04102 SlyX	80	15.3	SlyX

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000437554

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000417901	0.918	Gephyrin
2	9606.ENSP00000463653	0.851	RNA binding protein fox-1 homolog 3
3	9606.ENSP00000377250	0.737	Protein MON2 homolog
4	9606.ENSP00000366715	0.720	Transmembrane protein 236
5	9606.ENSP00000382178	0.700	MAM domain-containing glycosylphosphatidylinositol anchor protein 2
6	9606.ENSP00000290401	0.691	Neuroplastin
7	9606.ENSP00000378690	0.684	Calcium-binding protein 8
8	9606.ENSP00000253401	0.680	Rho guanine nucleotide exchange factor 9
9	9606.ENSP00000420091	0.674	SLIT and NTRK-like protein 3
10	9606.ENSP00000468263	0.666	ELKS/Rab6-interacting/CAST family member 1
11	9606.ENSP00000322609	0.659	Glutamate-rich protein 3
12	9606.ENSP00000298316	0.647	ADP-ribosylation factor 6
13	9606.ENSP00000444596	0.636	E3 ubiquitin-protein ligase MYCBP2
14	9606.ENSP00000373277	0.635	RNA-binding motif, single-stranded-interacting protein 3
15	9606.ENSP00000401633	0.633	Unconventional myosin-XVI
16	9606.ENSP00000440005	0.624	ADP-ribosylation factor 1
17	9606.ENSP00000457205	0.623	UPF0583 protein C15orf59
18	9606.ENSP00000262717	0.575	Cadherin-20
19	9606.ENSP00000429763	0.556	Protein FAM196A
20	9606.ENSP00000354923	0.545	Dystrophin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0009987	0.988	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0071840	0.906	cellular component organization or biogenesis
GO:0016043	0.904	cellular component organization
GO:0023051	0.856	regulation of signaling
GO:0010646	0.855	regulation of cell communication
GO:0048583	0.560	regulation of response to stimulus
GO:0009966	0.489	regulation of signal transduction
GO:0065009	0.403	regulation of molecular function
GO:1902531	0.403	regulation of intracellular signal transduction
GO:0050790	0.373	regulation of catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043229	0.995	intracellular organelle
GO:0005829	0.993	cytosol
GO:0043227	0.980	membrane-bounded organelle
GO:0031981	0.973	nuclear lumen
GO:0016020	0.968	membrane
GO:0005654	0.917	nucleoplasm
GO:0005886	0.890	plasma membrane
GO:0045202	0.591	synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]