StarFunc result for job id Q9UPP5

User Input

>input (1279 residues)
MSTDDQQKIQAAAFDKGDDRRLGKKPIFSSSQQRKQVSDSGDIKIKSWRGNNKKECWSYL
STNKKMKSDGLGASGHSSSTNRNSINKTLKQDDVKEKDGTKIASKITKELKTGGKNVSGK
PKTVTKSKTENGDKARLENMSPRQVVERSATAAAAATGQKNLLNGKGVRNQEGQISGARP
KVLTGNLNVQAKAKPLKKATGKDSPCLSIAGPSSRSTDSSMEFSISTECLDEPKENGSTE
EEKPSGHKLSFCDSPGQMMKNSVDSVKNSTVAIKSRPVSRVTNGTSNKKSIHEQDTNVNN
SVLKKVSGKGCSEPVPQAILKKRGTSNGCTAAQQRTKSTPSNLTKTQGSQGESPNSVKSS
VSSRQSDENVAKLDHNTTTEKQAPKRKMVKQVHTALPKVNAKIVAMPKNLNQSKKGETLN
NKDSKQKMPPGQVISKTQPSSQRPLKHETSTVQKSMFHDVRDNNNKDSVSEQKPHKPLIN
LASEISDAEALQSSCRPDPQKPLNDQEKEKLALECQNISKLDKSLKHELESKQICLDKSE
TKFPNHKETDDCDAANICCHSVGSDNVNSKFYSTTALKYMVSNPNENSLNSNPVCDLDST
SAGQIHLISDRENQVGRKDTNKQSSIKCVEDVSLCNPERTNGTLNSAQEDKKSKVPVEGL
TIPSKLSDESAMDEDKHATADSDVSSKCFSGQLSEKNSPKNMETSESPESHETPETPFVG
HWNLSTGVLHQRESPESDTGSATTSSDDIKPRSEDYDAGGSQDDDGSNDRGISKCGTMLC
HDFLGRSSSDTSTPEELKIYDSNLRIEVKMKKQSNNDLFQVNSTSDDEIPRKRPEIWSRS
AIVHSRERENIPRGSVQFAQEIDQVSSSADETEDERSEAENVAENFSISNPAPQQFQGII
NLAFEDATENECREFSATKKFKRSVLLSVDECEELGSDEGEVHTPFQASVDSFSPSDVFD
GISHEHHGRTCYSRFSRESEDNILECKQNKGNSVCKNESTVLDLSSIDSSRKNKQSVSAT
EKKNTIDVLSSRSRQLLREDKKVNNGSNVENDIQQRSKFLDSDVKSQERPCHLDLHQREP
NSDIPKNSSTKSLDSFRSQVLPQEGPVKESHSTTTEKANIALSAGDIDDCDTLAQTRMYD
HRPSKTLSPIYEMDVIEAFEQKVESETHVTDMDFEDDQHFAKQDWTLLKQLLSEQDSNLD
VTNSVPEDLSLAQYLINQTLLLARDSSKPQGITHIDTLNRWSELTSPLDSSASITMASFS
SEDCSPQGEWTILELETQH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A0X3	0.196	0.200	1.268E-85	1237	0.592	0.612	D4A0X3.pdb.gz	BTBD8_RAT BTB/POZ domain-containing protein 8 OS=Rattus norvegicus OX=10116 GN=Btbd8 PE=1 SV=4
2	AFDB:Q9VAW5	0.040	0.032	5.088E-3	1673	0.120	0.092	Q9VAW5.pdb.gz	LARP_DROME La-related protein 1 OS=Drosophila melanogaster OX=7227 GN=larp PE=1 SV=5
3	AFDB:Q8ILT4	0.043	0.028	7.323E-3	2280	0.134	0.075	Q8ILT4.pdb.gz	MCA3_PLAF7 Metacaspase-3 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=MCA3 PE=1 SV=1
4	AFDB:Q10124	0.031	0.029	9.112E-3	1647	0.129	0.100	Q10124.pdb.gz	PQE1_CAEEL Putative RNA exonuclease pqe-1 OS=Caenorhabditis elegans OX=6239 GN=pqe-1 PE=2 SV=2
5	AFDB:Q9VRM6	0.040	0.029	4.867E-2	1929	0.161	0.107	Q9VRM6.pdb.gz	Q9VRM6_DROME Lethal (3) persistent salivary gland 2 OS=Drosophila melanogaster OX=7227 GN=l(3)psg2 PE=4 SV=2
6	AFDB:A1ZBJ6	0.032	0.030	1.255E-1	1379	0.131	0.121	A1ZBJ6.pdb.gz	A1ZBJ6_DROME Rad, Gem/Kir family member 1, isoform B OS=Drosophila melanogaster OX=7227 GN=Rgk1 PE=4 SV=2
7	AFDB:Q6UB99	0.034	0.021	1.679E-1	2663	0.157	0.075	Q6UB99.pdb.gz	ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ANKRD11 PE=1 SV=3
8	AFDB:A0A0R4IJ26	0.032	0.025	2.089E-1	1760	0.150	0.109	A0A0R4IJ26.pdb.gz
9	AFDB:F4I096	0.034	0.027	2.089E-1	1921	0.145	0.096	F4I096.pdb.gz	MED13_ARATH Mediator of RNA polymerase II transcription subunit 13 OS=Arabidopsis thaliana OX=3702 GN=MED13 PE=1 SV=1
10	AFDB:Q8IHQ2	0.039	0.039	3.235E-1	1301	0.143	0.141	Q8IHQ2.pdb.gz	Q8IHQ2_PLAF7 Oocyst rupture protein 1, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1146600 PE=3 SV=1
11	PDB:7bt6r	0.025	0.103	2.325	230	0.013	0.070	7bt6r.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
12	PDB:6g2jb	0.030	0.235	8.021	83	0.008	0.120	6g2jb.pdb.gz	Cryo-EM structures of complex I from mouse heart mitochondria in two biochemically defined states.
13	PDB:6mzcM	0.025	0.189	8.021	104	0.011	0.135	6mzcM.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A0X3	0.0	1356	1749	0.592	0.433	BTBD8_RAT BTB/POZ domain-containing protein 8 OS=Rattus norvegicus OX=10116 GN=Btbd8 PE=1 SV=4
2	Q5XKL5	0.0	2615	1792	1.000	0.714	BTBD8_HUMAN BTB/POZ domain-containing protein 8 OS=Homo sapiens OX=9606 GN=BTBD8 PE=1 SV=3
3	Q7VLE8	6.0	33.9	4152	0.028	0.009	Q7VLE8_HAEDU Large supernatant protein 1 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) OX=233412 GN=lspA1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15363 DUF4596	3.3e-19	80.3	Domain of unknown function (DUF4596)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359404

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000233336	0.646	Tubulin--tyrosine ligase
2	9606.ENSP00000464162	0.643	GREB1-like protein
3	9606.ENSP00000386385	0.642	Peroxisomal membrane protein 4
4	9606.ENSP00000377043	0.622	Tubulin polyglutamylase TTLL6
5	9606.ENSP00000343686	0.612	BTB/POZ domain-containing protein 8
6	9606.ENSP00000371548	0.544	Leucine rich repeat LGI family member 2
7	9606.ENSP00000251127	0.506	Sodium leak channel non-selective protein
8	9606.ENSP00000386239	0.500	Tonsoku-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.458	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.839	biological regulation
GO:0050789	0.830	regulation of biological process
GO:0009987	0.760	cellular process
GO:0050794	0.757	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0005654	0.992	nucleoplasm
GO:0043232	0.579	intracellular non-membrane-bounded organelle
GO:0005737	0.575	cytoplasm
GO:0012505	0.514	endomembrane system
GO:0005829	0.433	cytosol
GO:0120025	0.393	plasma membrane bounded cell projection
GO:0015630	0.391	microtubule cytoskeleton
GO:0030669	0.390	clathrin-coated endocytic vesicle membrane
GO:0008021	0.384	synaptic vesicle
GO:0030122	0.384	AP-2 adaptor complex
GO:0044306	0.380	neuron projection terminus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]