StarFunc result for job id Q9UPQ0

User Input

>input (1083 residues)
MACPALGLEALQPLQPEPPPEPAFSEAQKWIEQVTGRSFGDKDFRTGLENGILLCELLNA
IKPGLVKKINRLPTPIAGLDNIILFLRGCKELGLKESQLFDPSDLQDTSNRVTVKSLDYS
RKLKNVLVTIYWLGKAANSCTSYSGTTLNLKEFEGLLAQMRKDTDDIESPKRSIRDSGYI
DCWDSERSDSLSPPRHGRDDSFDSLDSFGSRSRQTPSPDVVLRGSSDGRGSDSESDLPHR
KLPDVKKDDMSARRTSHGEPKSAVPFNQYLPNKSNQTAYVPAPLRKKKAEREEYRKSWST
ATSPLGGERPFRYGPRTPVSDDAESTSMFDMRCEEEAAVQPHSRARQEQLQLINNQLREE
DDKWQDDLARWKSRRRSVSQDLIKKEEERKKMEKLLAGEDGTSERRKSIKTYREIVQEKE
RRERELHEAYKNARSQEEAEGILQQYIERFTISEAVLERLEMPKILERSHSTEPNLSSFL
NDPNPMKYLRQQSLPPPKFTATVETTIARASVLDTSMSAGSGSPSKTVTPKAVPMLTPKP
YSQPKNSQDVLKTFKVDGKVSVNGETVHREEEKERECPTVAPAHSLTKSQMFEGVARVHG
SPLELKQDNGSIEINIKKPNSVPQELAATTEKTEPNSQEDKNDGGKSRKGNIELASSEPQ
HFTTTVTRCSPTVAFVEFPSSPQLKNDVSEEKDQKKPENEMSGKVELVLSQKVVKPKSPE
PEATLTFPFLDKMPEANQLHLPNLNSQVDSPSSEKSPVMTPQFKFWAWDPEEERRRQEKW
QQEQERLLQERYQKEQDKLKEEWEKAQKEVEEEERRYYEEERKIIEDTVVPFTVSSSSAD
QLSTSSSMTEGSGTMNKIDLGNCQDEKQDRRWKKSFQGDDSDLLLKTRESDRLEEKGSLT
EGALAHSGNPVSKGVHEDHQLDTEAGAPHCGTNPQLAQDPSQNQQTSNPTHSSEDVKPKT
LPLDKSINHQIESPSERRKKSPREHFQAGPFSPCSPTPPGQSPNRSISGKKLCSSCGLPL
GKGAAMIIETLNLYFHIQCFRCGICKGQLGDAVSGTDVRIRNGLLNCNDCYMRSRSAGQP
TTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UPQ0	1.000	1.000	0.000	1083	1.000	1.000	Q9UPQ0.pdb.gz	LIMC1_HUMAN LIM and calponin homology domains-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMCH1 PE=1 SV=4
2	AFDB:F1R7D1	0.127	0.118	8.386E-35	1173	0.295	0.273	F1R7D1.pdb.gz
3	AFDB:F6NN15	0.134	0.105	2.041E-31	1384	0.312	0.244	F6NN15.pdb.gz	F6NN15_DANRE LIM domain 7b OS=Danio rerio OX=7955 GN=DKEY-180K21.1 PE=4 SV=2
4	AFDB:A1Z6I7	0.047	0.040	8.670E-4	1460	0.130	0.097	A1Z6I7.pdb.gz	A1Z6I7_DROME Bub1-related kinase OS=Drosophila melanogaster OX=7227 GN=BubR1 PE=1 SV=1
5	AFDB:Q96T23	0.071	0.057	1.197E-3	1441	0.120	0.090	Q96T23.pdb.gz	RSF1_HUMAN Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1 PE=1 SV=2
6	AFDB:F1LR12	0.089	0.042	7.862E-3	2425	0.142	0.064	F1LR12.pdb.gz	F1LR12_RAT Neuron navigator 2 OS=Rattus norvegicus OX=10116 GN=Nav2 PE=1 SV=3
7	PDB:4kfzB	0.061	0.377	1.180E-2	148	0.016	0.115	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
8	AFDB:A0A1B0GTU4	0.060	0.060	1.346E-2	1081	0.132	0.132	A0A1B0GTU4.pdb.gz	A0A1B0GTU4_HUMAN Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=1 SV=1
9	AFDB:Q8IVL0	0.096	0.047	1.582E-2	2385	0.133	0.060	Q8IVL0.pdb.gz	NAV3_HUMAN Neuron navigator 3 OS=Homo sapiens OX=9606 GN=NAV3 PE=1 SV=3
10	AFDB:A0A024R3V0	0.068	0.116	1.859E-2	558	0.076	0.147	A0A024R3V0.pdb.gz
11	AFDB:Q8IVL1	0.087	0.041	2.432E-2	2488	0.138	0.060	Q8IVL1.pdb.gz	NAV2_HUMAN Neuron navigator 2 OS=Homo sapiens OX=9606 GN=NAV2 PE=1 SV=3
12	PDB:1b8tA	0.055	0.270	6.597E-2	192	0.022	0.125	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
13	PDB:1imlA	0.055	0.603	1.401E-1	76	0.013	0.184	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
14	PDB:7sj9M	0.087	0.583	3.311E-1	131	0.019	0.160	7sj9M.pdb.gz	Structural transitions in the GTP cap visualized by cryo-electron microscopy of catalytically inactive microtubules.
15	PDB:1qz4A	0.044	0.146	3.494E-1	213	0.029	0.146	1qz4A.pdb.gz
16	PDB:7yziA	0.051	0.108	4.333E-1	378	0.023	0.066	7yziA.pdb.gz	Structure of Mycobacterium tuberculosis Cya, an evolutionary ancestor of the mammalian membrane adenylyl cyclases.
17	PDB:7pubFh	0.047	0.149	4.572E-1	274	0.024	0.095	7pubFh.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
18	PDB:7jv7C	0.047	0.120	7.418E-1	250	0.022	0.096	7jv7C.pdb.gz
19	PDB:6o6pA	0.043	0.164	8.717E-1	188	0.011	0.064	6o6pA.pdb.gz	Mycobacterium tuberculosis FasR senses long fatty acyl-CoA through a tunnel and a hydrophobic transmission spine.
20	PDB:6yxyBL	0.039	0.098	9.707E-1	259	0.022	0.093	6yxyBL.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UPQ0	0.0	2230	1083	1.000	1.000	LIMC1_HUMAN LIM and calponin homology domains-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMCH1 PE=1 SV=4
2	A0A8I5ZWT3	8.47e-105	361	1395	0.187	0.146	A0A8I5ZWT3_RAT LIM domain 7 OS=Rattus norvegicus OX=10116 GN=Lmo7 PE=1 SV=1
3	A0A0G2K174	8.62e-105	361	1391	0.185	0.144	A0A0G2K174_RAT LIM domain 7 OS=Rattus norvegicus OX=10116 GN=Lmo7 PE=1 SV=2
4	Q6JBI7	1.47e-88	316	1729	0.147	0.092	Q6JBI7_RAT LMO7a OS=Rattus norvegicus OX=10116 GN=Lmo7 PE=2 SV=1
5	A0A0G2K8R3	1.98e-88	315	1719	0.147	0.092	A0A0G2K8R3_RAT LIM domain 7 OS=Rattus norvegicus OX=10116 GN=Lmo7 PE=1 SV=2
6	E9PYF4	2.74e-87	311	1699	0.148	0.094	E9PYF4_MOUSE LIM domain only 7 OS=Mus musculus OX=10090 GN=Lmo7 PE=1 SV=1
7	Q8WWI1	8.19e-87	310	1683	0.145	0.093	LMO7_HUMAN LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7 PE=1 SV=3
8	A0A8I5ZR48	4.68e-75	274	1356	0.153	0.122	A0A8I5ZR48_RAT LIM domain 7 OS=Rattus norvegicus OX=10116 GN=Lmo7 PE=1 SV=1
9	F6NN15	1.51e-64	241	1384	0.119	0.093	F6NN15_DANRE LIM domain 7b OS=Danio rerio OX=7955 GN=DKEY-180K21.1 PE=4 SV=2
10	A0A8I6AMI4	4.02e-60	228	1662	0.113	0.073	A0A8I6AMI4_RAT LIM domain 7 OS=Rattus norvegicus OX=10116 GN=Lmo7 PE=1 SV=1
11	A0A8I6AAI2	4.77e-60	228	1657	0.113	0.074	A0A8I6AAI2_RAT LIM domain 7 OS=Rattus norvegicus OX=10116 GN=Lmo7 PE=1 SV=1
12	Q8MNT0	2.41e-20	100	1099	0.032	0.032	Q8MNT0_CAEEL PDZ domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lim-8 PE=1 SV=1
13	Q95QI3	3.27e-20	99.4	1004	0.032	0.035	Q95QI3_CAEEL PDZ domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lim-8 PE=1 SV=1
14	Q95QI2	3.50e-20	99.4	868	0.032	0.040	Q95QI2_CAEEL PDZ domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lim-8 PE=1 SV=1
15	Q55GV9	1.17e-19	97.1	686	0.051	0.080	LIMCH_DICDI Calponin homology and LIM domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=ChLim PE=1 SV=1
16	Q6PBA5	3.74e-14	77.0	307	0.036	0.127	Q6PBA5_DANRE Calponin OS=Danio rerio OX=7955 GN=wu:fb93a05 PE=1 SV=1
17	Q08290	1.02e-13	75.5	297	0.033	0.121	CNN1_RAT Calponin-1 OS=Rattus norvegicus OX=10116 GN=Cnn1 PE=1 SV=1
18	Q9GK38	1.08e-13	75.5	297	0.033	0.121	CNN1_MUSPF Calponin-1 OS=Mustela putorius furo OX=9669 GN=CNN1 PE=1 SV=1
19	P26932	4.21e-12	70.5	292	0.041	0.151	CNN1_CHICK Calponin-1 OS=Gallus gallus OX=9031 GN=CNN1 PE=1 SV=2
20	P51911	5.58e-12	70.1	297	0.034	0.125	CNN1_HUMAN Calponin-1 OS=Homo sapiens OX=9606 GN=CNN1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11971 CAMSAP_CH	4.1e+02	12.2	CAMSAP CH domain
2	PF00307 CH	2.1e-10	52.1	Calponin homology (CH) domain
3	PF15949 DUF4757	6.3e-63	223.5	Domain of unknown function (DUF4757)
4	PF00412 LIM	0.00062	31.3	LIM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000316891

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000435585	0.719	Epidermal growth factor receptor kinase substrate 8-like protein 2
2	9606.ENSP00000484492	0.708	Uncharacterized protein C8orf59
3	9606.ENSP00000396452	0.702	Pseudouridine-5'-phosphatase
4	9606.ENSP00000362260	0.685	Zinc finger protein 711
5	9606.ENSP00000440847	0.663	Zinc finger protein 185
6	9606.ENSP00000401437	0.652	LIM domain-binding protein 3
7	9606.ENSP00000353210	0.641	ADP-ribosylation factor-like protein 9
8	9606.ENSP00000422473	0.633	Transmembrane protein 33
9	9606.ENSP00000273261	0.630	Leucine-rich repeats and immunoglobulin-like domains protein 1
10	9606.ENSP00000296411	0.618	Methionine aminopeptidase 1
11	9606.ENSP00000416787	0.616	Polypeptide N-acetylgalactosaminyltransferase 11
12	9606.ENSP00000425658	0.616	Ankyrin repeat domain-containing protein 50
13	9606.ENSP00000265806	0.614	R3H domain and coiled-coil containing 1
14	9606.ENSP00000274008	0.614	Spermatogenesis-associated protein 5
15	9606.ENSP00000331577	0.613	Zinc finger protein 397
16	9606.ENSP00000413073	0.607	Zinc finger protein 445
17	9606.ENSP00000326759	0.594	Leucine-rich repeats and immunoglobulin-like domains protein 3
18	9606.ENSP00000385347	0.576	Transmembrane anterior posterior transformation protein 1 homolog
19	9606.ENSP00000415090	0.576	Unconventional myosin-VIIb
20	9606.ENSP00000226382	0.570	Paired mesoderm homeobox protein 2B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0045159	1.000	myosin II binding
GO:0032036	1.000	myosin heavy chain binding
GO:0032034	0.664	myosin II head/neck binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0048522	0.972	positive regulation of cellular process
GO:0032970	0.969	regulation of actin filament-based process
GO:0051493	0.965	regulation of cytoskeleton organization
GO:1902903	0.963	regulation of supramolecular fiber organization
GO:0150116	0.963	regulation of cell-substrate junction organization
GO:0019222	0.959	regulation of metabolic process
GO:0030029	0.958	actin filament-based process
GO:0060255	0.946	regulation of macromolecule metabolic process
GO:0044087	0.940	regulation of cellular component biogenesis
GO:0030155	0.917	regulation of cell adhesion
GO:0032231	0.911	regulation of actin filament bundle assembly
GO:0010810	0.907	regulation of cell-substrate adhesion
GO:0051130	0.899	positive regulation of cellular component organization
GO:0040012	0.892	regulation of locomotion
GO:0110020	0.889	regulation of actomyosin structure organization
GO:0031323	0.878	regulation of cellular metabolic process
GO:1902905	0.871	positive regulation of supramolecular fiber organization
GO:0051492	0.870	regulation of stress fiber assembly
GO:0044089	0.867	positive regulation of cellular component biogenesis
GO:0051171	0.850	regulation of nitrogen compound metabolic process
GO:0080090	0.847	regulation of primary metabolic process
GO:0051495	0.837	positive regulation of cytoskeleton organization
GO:0001952	0.834	regulation of cell-matrix adhesion
GO:0032233	0.824	positive regulation of actin filament bundle assembly
GO:2000145	0.808	regulation of cell motility
GO:0048519	0.776	negative regulation of biological process
GO:0051496	0.755	positive regulation of stress fiber assembly
GO:0090109	0.710	regulation of cell-substrate junction assembly
GO:0048523	0.709	negative regulation of cellular process
GO:0051174	0.646	regulation of phosphorus metabolic process
GO:0010604	0.522	positive regulation of macromolecule metabolic process
GO:0051173	0.506	positive regulation of nitrogen compound metabolic process
GO:0031325	0.461	positive regulation of cellular metabolic process
GO:0051893	0.448	regulation of focal adhesion assembly
GO:0030334	0.446	regulation of cell migration
GO:0051246	0.426	regulation of protein metabolic process
GO:0051247	0.329	positive regulation of protein metabolic process
GO:0001934	0.316	positive regulation of protein phosphorylation
GO:2000146	0.315	negative regulation of cell motility
GO:0048870	0.314	cell motility
GO:0030336	0.314	negative regulation of cell migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.998	protein-containing complex
GO:0005856	0.996	cytoskeleton
GO:0015629	0.973	actin cytoskeleton
GO:0042641	0.956	actomyosin
GO:0032432	0.955	actin filament bundle
GO:0097517	0.946	contractile actin filament bundle
GO:0001725	0.938	stress fiber
GO:0005737	0.926	cytoplasm
GO:0016459	0.844	myosin complex
GO:0016020	0.833	membrane
GO:0016460	0.825	myosin II complex
GO:0071944	0.752	cell periphery
GO:0005886	0.510	plasma membrane
GO:0043227	0.467	membrane-bounded organelle
GO:0005829	0.437	cytosol
GO:0043231	0.433	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]