StarFunc result for job id Q9UPQ3

User Input

>input (857 residues)
MNYQQQLANSAAIRAEIQRFESVHPNIYSIYELLERVEEPVLQNQIREHVIAIEDAFVNS
QEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLL
LIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHYYSRMANYRNTSEIPLVLVGTQD
AISSANPRVIDDARARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSI
GPCKSLPNSPSHSSVCSAQVSAVHISQTSNGGGSLSDYSSSVPSTPSTSQKELRIDVPPT
ANTPTPVRKQSKRRSNLFTSRKGSDPDKEKKGLESRADSIGSGRAIPIKQGMLLKRSGKS
LNKEWKKKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPGKRPPRATSACAPI
SSPKTNGLSKDMSSLHISPNSGNVTSASGSQMASGISLVSFNSRPDGMHQRSYSVSSADQ
WSEATVIANSAISSDTGLGDSVCSSPSISSTTSPKLDPPPSPHANRKKHRRKKSTSNFKA
DGLSGTAEEQEENFEFIIVSLTGQTWHFEATTYEERDAWVQAIESQILASLQSCESSKNK
SRLTSQSEAMALQSIRNMRGNSHCVDCETQNPNWASLNLGALMCIECSGIHRNLGTHLSR
VRSLDLDDWPVELIKVMSSIGNELANSVWEESSQGRTKPSVDSTREEKERWIRAKYEQKL
FLAPLPCTELSLGQHLLRATADEDLRTAILLLAHGSRDEVNETCGEGDGRTALHLACRKG
NVVLAQLLIWYGVDVTARDAHGNTALAYARQASSQECIDVLLQYGCPDERFVLMATPNLS
RRNNNRNNSSGRVPTII

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8VHH5	0.434	0.411	0.000	910	0.705	0.664	Q8VHH5.pdb.gz	AGAP3_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Agap3 PE=1 SV=1
2	AFDB:Q9UPQ3	1.000	1.000	0.000	857	1.000	1.000	Q9UPQ3.pdb.gz	AGAP1_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=AGAP1 PE=1 SV=4
3	AFDB:U6A022	0.522	0.548	1.861E-101	808	0.652	0.692	U6A022.pdb.gz	U6A022_RAT ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 OS=Rattus norvegicus OX=10116 GN=Agap3 PE=2 SV=1
4	AFDB:A0A024RB55	0.464	0.474	1.562E-85	836	0.533	0.547	A0A024RB55.pdb.gz
5	AFDB:A0JMI1	0.470	0.483	8.151E-85	827	0.508	0.526	A0JMI1.pdb.gz	A0JMI1_DANRE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Danio rerio OX=7955 GN=agap2 PE=2 SV=1
6	PDB:3lvqE	0.230	0.456	4.043E-14	420	0.085	0.174	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
7	PDB:7sd0B	0.181	0.824	5.445E-12	174	0.049	0.241	7sd0B.pdb.gz	Structural basis for SHOC2 modulation of RAS signalling.
8	PDB:6zizA	0.181	0.833	6.058E-12	170	0.050	0.253	6zizA.pdb.gz	Drugging all RAS isoforms with one pocket.
9	PDB:6kykC	0.180	0.860	6.389E-12	169	0.044	0.225	6kykC.pdb.gz	Shank3 Binds to and Stabilizes the Active Form of Rap1 and HRas GTPases via Its NTD-ANK Tandem with Distinct Mechanisms.
10	PDB:7e1tB	0.175	0.810	1.668E-11	174	0.050	0.247	7e1tB.pdb.gz	Nde1 is a Rab9 effector for loading late endosomes to cytoplasmic dynein motor complex.
11	PDB:2bovA	0.188	0.883	1.759E-11	173	0.048	0.237	2bovA.pdb.gz	Molecular Recognition of an Adp-Ribosylating Clostridium Botulinum C3 Exoenzyme by Rala Gtpase
12	AFDB:A0A140LH27	0.160	0.090	1.813E-11	1664	0.153	0.079	A0A140LH27.pdb.gz	A0A140LH27_DANRE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 isoform X1 OS=Danio rerio OX=7955 GN=arap3 PE=4 SV=1
13	PDB:3t5gA	0.176	0.831	4.352E-11	171	0.043	0.216	3t5gA.pdb.gz	Arl2-GTP and Arl3-GTP regulate a GDI-like transport system for farnesylated cargo.
14	PDB:1vg8A	0.183	0.794	1.264E-10	184	0.048	0.223	1vg8A.pdb.gz	Structure of the Rab7:REP-1 complex: insights into the mechanism of Rab prenylation and choroideremia disease
15	AFDB:Q54T92	0.185	0.077	1.449E-10	2107	0.106	0.043	Q54T92.pdb.gz	Q54T92_DICDI Rab GTPase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=comB PE=4 SV=1
16	PDB:5szjA	0.180	0.829	2.395E-10	175	0.032	0.154	5szjA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
17	PDB:2atxA	0.178	0.745	2.526E-10	186	0.049	0.226	2atxA.pdb.gz	An electrostatic steering mechanism of Cdc42 recognition by Wiskott-Aldrich syndrome proteins
18	AFDB:A0A0B4LFV4	0.183	0.210	7.788E-3	742	0.036	0.042	A0A0B4LFV4.pdb.gz	A0A0B4LFV4_DROME Rad, Gem/Kir family member 2, isoform C OS=Drosophila melanogaster OX=7227 GN=Rgk2 PE=4 SV=1
19	AFDB:Q5H9F3	0.097	0.050	9.138E-3	1711	0.125	0.063	Q5H9F3.pdb.gz	BCORL_HUMAN BCL-6 corepressor-like protein 1 OS=Homo sapiens OX=9606 GN=BCORL1 PE=1 SV=2
20	AFDB:D6R9G8	0.103	0.102	2.385E-2	858	0.096	0.096	D6R9G8.pdb.gz	D6R9G8_HUMAN Synuclein alpha interacting protein (Fragment) OS=Homo sapiens OX=9606 GN=SNCAIP PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0JMI1	0.0	779	827	0.513	0.532	A0JMI1_DANRE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Danio rerio OX=7955 GN=agap2 PE=2 SV=1
2	F8VVT9	0.0	806	1192	0.505	0.363	F8VVT9_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1
3	J3KNM6	0.0	813	1036	0.505	0.418	J3KNM6_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 (Fragment) OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1
4	Q3UHD9	0.0	786	1186	0.515	0.372	AGAP2_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Agap2 PE=1 SV=1
5	Q8CGU4	0.0	793	1186	0.518	0.374	AGAP2_RAT Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Agap2 PE=1 SV=1
6	Q8VHH5	0.0	1217	910	0.704	0.663	AGAP3_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Agap3 PE=1 SV=1
7	Q99490	0.0	806	1192	0.505	0.363	AGAP2_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=2
8	Q9NGC3	0.0	749	995	0.492	0.424	CEG1A_DROME Centaurin-gamma-1A OS=Drosophila melanogaster OX=7227 GN=CenG1A PE=2 SV=2
9	Q9UPQ3	0.0	1778	857	1.000	1.000	AGAP1_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=AGAP1 PE=1 SV=4
10	U6A022	0.0	748	808	0.414	0.439	U6A022_RAT ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 OS=Rattus norvegicus OX=10116 GN=Agap3 PE=2 SV=1
11	Q9XX14	5.26e-63	233	1107	0.161	0.125	CNT2_CAEEL Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 OS=Caenorhabditis elegans OX=6239 GN=cnt-2 PE=1 SV=2
12	Q54WI0	1.32e-38	158	1333	0.139	0.089	Q54WI0_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279649 PE=4 SV=1
13	Q4QQN0	2.93e-34	142	626	0.093	0.128	Q4QQN0_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
14	Q6NXL5	5.99e-34	142	833	0.093	0.096	Q6NXL5_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
15	A2ADA6	6.08e-34	142	829	0.093	0.097	A2ADA6_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
16	Q3UH98	6.48e-34	142	833	0.093	0.096	Q3UH98_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
17	Q9DE64	7.85e-32	135	757	0.099	0.112	Q9DE64_CHICK p95-APP2 OS=Gallus gallus OX=9031 GN=p95-APP2 PE=2 SV=1
18	A0A0R4IPR8	1.97e-31	134	761	0.099	0.112	A0A0R4IPR8_DANRE ARF GTPase-activating protein GIT1 isoform X1 OS=Danio rerio OX=7955 GN=git1 PE=1 SV=1
19	E7FAZ2	2.16e-31	134	752	0.099	0.113	E7FAZ2_DANRE ARF GTPase-activating protein GIT1 isoform X2 OS=Danio rerio OX=7955 GN=git1 PE=1 SV=1
20	Q9DG15	3.62e-31	133	740	0.090	0.104	Q9DG15_CHICK p95-APP1 OS=Gallus gallus OX=9031 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	6.3e-06	37.6	Ankyrin repeat
2	PF12796 Ank_2	1.4e-06	40.1	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	0.31	22.6	Ankyrin repeat
4	PF13637 Ank_4	0.0038	29.0	Ankyrin repeats (many copies)
5	PF13857 Ank_5	4.9e-05	34.8	Ankyrin repeats (many copies)
6	PF01412 ArfGap	4.2e-35	131.7	Putative GTPase activating protein for Arf
7	PF16663 MAGI_u1	2.5e+02	13.0	Unstructured region on MAGI
8	PF00169 PH	2.4e-07	42.6	PH domain
9	PF15413 PH_11	9.5	18.1	Pleckstrin homology domain
10	PF15404 PH_4	4.5e+02	12.1	Pleckstrin homology domain
11	PF15406 PH_6	5.1	18.8	Pleckstrin homology domain
12	PF15409 PH_8	3e+02	13.1	Pleckstrin homology domain
13	PF00071 Ras	2.4e-14	64.8	Ras family
14	PF08477 Roc	2.5	19.7	Ras of Complex, Roc, domain of DAPkinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307634

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000440005	0.847	ADP-ribosylation factor 1
2	9606.ENSP00000336666	0.729	AP-1 complex subunit sigma-1A
3	9606.ENSP00000000233	0.646	ADP-ribosylation factor 5
4	9606.ENSP00000298316	0.644	ADP-ribosylation factor 6
5	9606.ENSP00000302251	0.604	Homeobox protein GBX-2
6	9606.ENSP00000385000	0.586	Kinesin-like protein KIF2A
7	9606.ENSP00000333298	0.552	Lysosome-associated membrane glycoprotein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0005543	0.996	phospholipid binding
GO:0098772	0.594	molecular function regulator activity
GO:0030234	0.497	enzyme regulator activity
GO:0043168	0.497	anion binding
GO:0003824	0.471	catalytic activity
GO:0060589	0.385	nucleoside-triphosphatase regulator activity
GO:0016787	0.380	hydrolase activity
GO:0030695	0.375	GTPase regulator activity
GO:0017111	0.310	ribonucleoside triphosphate phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.878	developmental process
GO:0009987	0.599	cellular process
GO:0048856	0.565	anatomical structure development
GO:0065007	0.454	biological regulation
GO:0032501	0.380	multicellular organismal process
GO:0050789	0.369	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0071944	0.989	cell periphery
GO:0005829	0.983	cytosol
GO:0016020	0.956	membrane
GO:0012505	0.951	endomembrane system
GO:0005634	0.911	nucleus
GO:0005886	0.786	plasma membrane
GO:0030054	0.555	cell junction
GO:0032991	0.330	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.380	Hydrolases.
RHEA:23680	0.310	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.310	nucleoside-triphosphate phosphatase.

[back to server]