StarFunc result for job id Q9UPQ4

User Input

>input (493 residues)
MERSPDVSPGPSRSFKEELLCAVCYDPFRDAVTLRCGHNFCRGCVSRCWEVQVSPTCPVC
KDRASPADLRTNHTLNNLVEKLLREEAEGARWTSYRFSRVCRLHRGQLSLFCLEDKELLC
CSCQADPRHQGHRVQPVKDTAHDFRAKCRNMEHALREKAKAFWAMRRSYEAIAKHNQVEA
AWLEGRIRQEFDKLREFLRVEEQAILDAMAEETRQKQLLADEKMKQLTEETEVLAHEIER
LQMEMKEDDVSFLMKHKSRKRRLFCTMEPEPVQPGMLIDVCKYLGSLQYRVWKKMLASVE
SVPFSFDPNTAAGWLSVSDDLTSVTNHGYRVQVENPERFSSAPCLLGSRVFSQGSHAWEV
ALGGLQSWRVGVVRVRQDSGAEGHSHSCYHDTRSGFWYVCRTQGVEGDHCVTSDPATSPL
VLAIPRRLRVELECEEGELSFYDAERHCHLYTFHARFGEVRPYFYLGGARGAGPPEPLRI
CPLHISVKEELDG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UPQ4	1.000	1.000	8.108E-93	493	1.000	1.000	Q9UPQ4.pdb.gz	TRI35_HUMAN E3 ubiquitin-protein ligase TRIM35 OS=Homo sapiens OX=9606 GN=TRIM35 PE=1 SV=2
2	AFDB:Q8C006	0.942	0.928	4.214E-80	501	0.817	0.804	Q8C006.pdb.gz	TRI35_MOUSE E3 ubiquitin-protein ligase TRIM35 OS=Mus musculus OX=10090 GN=Trim35 PE=1 SV=2
3	AFDB:A0A060IVL7	0.344	0.316	8.172E-37	548	0.292	0.263	A0A060IVL7.pdb.gz	A0A060IVL7_DANRE Tripartite motif containing 69 protein OS=Danio rerio OX=7955 GN=TRIM69 PE=2 SV=1
4	AFDB:Q5NCC9	0.353	0.359	5.005E-36	485	0.280	0.285	Q5NCC9.pdb.gz	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1
5	AFDB:A0A024RCR1	0.355	0.357	5.932E-36	488	0.276	0.279	A0A024RCR1.pdb.gz
6	AFDB:Q3UWZ0	0.346	0.363	8.818E-36	467	0.278	0.293	Q3UWZ0.pdb.gz	TRI75_MOUSE Tripartite motif-containing protein 75 OS=Mus musculus OX=10090 GN=Trim75 PE=1 SV=1
7	AFDB:Q9C029	0.398	0.386	1.948E-35	511	0.278	0.268	Q9C029.pdb.gz	TRIM7_HUMAN E3 ubiquitin-protein ligase TRIM7 OS=Homo sapiens OX=9606 GN=TRIM7 PE=1 SV=2
8	AFDB:Q495X7	0.342	0.356	6.773E-35	471	0.274	0.287	Q495X7.pdb.gz	TRI60_HUMAN Tripartite motif-containing protein 60 OS=Homo sapiens OX=9606 GN=TRIM60 PE=1 SV=2
9	AFDB:A0A024RCP5	0.360	0.344	1.263E-34	518	0.276	0.263	A0A024RCP5.pdb.gz	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
10	AFDB:Q923T7	0.392	0.381	1.497E-34	510	0.276	0.267	Q923T7.pdb.gz	TRIM7_MOUSE E3 ubiquitin-protein ligase TRIM7 OS=Mus musculus OX=10090 GN=Trim7 PE=2 SV=2
11	PDB:7y4sA	0.314	0.443	6.790E-18	343	0.166	0.239	7y4sA.pdb.gz
12	PDB:4b3nA	0.260	0.232	1.270E-11	557	0.089	0.079	4b3nA.pdb.gz	Structural Insight Into HIV-1 Capsid Recognition by Rhesus Trim5Alpha
13	PDB:7z36B	0.203	0.219	3.524E-8	446	0.118	0.130	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
14	PDB:7nsba	0.240	0.211	7.227E-6	568	0.077	0.067	7nsba.pdb.gz
15	PDB:4tn3B	0.306	0.404	1.074E-5	362	0.085	0.116	4tn3B.pdb.gz	Structural studies of postentry restriction factors reveal antiparallel dimers that enable avid binding to the HIV-1 capsid lattice.
16	PDB:7ccbA	0.248	0.677	1.074E-5	164	0.041	0.122	7ccbA.pdb.gz
17	PDB:6swy1	0.233	0.213	2.512E-5	542	0.075	0.068	6swy1.pdb.gz
18	PDB:7nscA	0.250	0.418	1.298E-4	276	0.055	0.098	7nscA.pdb.gz
19	PDB:1umzA	0.202	0.333	2.468E-3	267	0.047	0.086	1umzA.pdb.gz	Crystal Structures of a Poplar Xyloglucan Endotransglycosylase Reveal Details of Transglycosylation Acceptor Binding
20	PDB:7cf9A	0.192	0.032	2.612E-3	3949	0.053	0.007	7cf9A.pdb.gz	Structural basis for diamide modulation of ryanodine receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8C006	0.0	850	501	0.817	0.804	TRI35_MOUSE E3 ubiquitin-protein ligase TRIM35 OS=Mus musculus OX=10090 GN=Trim35 PE=1 SV=2
2	Q9UPQ4	0.0	1021	493	1.000	1.000	TRI35_HUMAN E3 ubiquitin-protein ligase TRIM35 OS=Homo sapiens OX=9606 GN=TRIM35 PE=1 SV=2
3	A0A060IVL7	1.09e-58	204	548	0.308	0.277	A0A060IVL7_DANRE Tripartite motif containing 69 protein OS=Danio rerio OX=7955 GN=TRIM69 PE=2 SV=1
4	E7F8P0	1.29e-58	204	548	0.308	0.277	E7F8P0_DANRE Tripartite motif-containing 69 OS=Danio rerio OX=7955 GN=rnf36 PE=4 SV=1
5	P19474	3.34e-50	180	475	0.310	0.322	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
6	Q495X7	1.54e-49	178	471	0.286	0.299	TRI60_HUMAN Tripartite motif-containing protein 60 OS=Homo sapiens OX=9606 GN=TRIM60 PE=1 SV=2
7	Q96F44	1.70e-49	178	468	0.302	0.318	TRI11_HUMAN E3 ubiquitin-protein ligase TRIM11 OS=Homo sapiens OX=9606 GN=TRIM11 PE=1 SV=2
8	Q5NCC9	4.61e-48	174	485	0.302	0.307	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1
9	Q9BVG3	2.80e-47	172	475	0.284	0.295	TRI62_HUMAN E3 ubiquitin-protein ligase TRIM62 OS=Homo sapiens OX=9606 GN=TRIM62 PE=1 SV=1
10	A6NK02	5.12e-47	171	468	0.276	0.291	TRI75_HUMAN Tripartite motif-containing protein 75 OS=Homo sapiens OX=9606 GN=TRIM75 PE=3 SV=2
11	Q80V85	8.81e-47	171	475	0.280	0.291	TRI62_MOUSE E3 ubiquitin-protein ligase TRIM62 OS=Mus musculus OX=10090 GN=Trim62 PE=2 SV=1
12	Q99PQ2	1.38e-46	170	467	0.292	0.308	TRI11_MOUSE E3 ubiquitin-protein ligase TRIM11 OS=Mus musculus OX=10090 GN=Trim11 PE=1 SV=1
13	Q86WT6	1.43e-46	171	500	0.292	0.288	TRI69_HUMAN E3 ubiquitin-protein ligase TRIM69 OS=Homo sapiens OX=9606 GN=TRIM69 PE=1 SV=2
14	A0A1U9X8R9	4.67e-46	169	513	0.302	0.290	A0A1U9X8R9_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=2
15	P14373	4.67e-46	169	513	0.302	0.290	TRI27_HUMAN Zinc finger protein RFP OS=Homo sapiens OX=9606 GN=TRIM27 PE=1 SV=1
16	A0A024RCP5	7.85e-46	169	518	0.292	0.278	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
17	Q9HCM9	7.85e-46	169	518	0.292	0.278	TRI39_HUMAN E3 ubiquitin-protein ligase TRIM39 OS=Homo sapiens OX=9606 GN=TRIM39 PE=1 SV=2
18	Q62158	1.03e-45	169	513	0.296	0.285	TRI27_MOUSE Zinc finger protein RFP OS=Mus musculus OX=10090 GN=Trim27 PE=1 SV=2
19	Q3UWZ0	5.02e-45	166	467	0.286	0.302	TRI75_MOUSE Tripartite motif-containing protein 75 OS=Mus musculus OX=10090 GN=Trim75 PE=1 SV=1
20	Q923T7	4.79e-43	161	510	0.290	0.280	TRIM7_MOUSE E3 ubiquitin-protein ligase TRIM7 OS=Mus musculus OX=10090 GN=Trim7 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05290 Baculo_IE-1	4.3	18.7	Baculovirus immediate-early protein (IE-0)
2	PF14447 Prok-RING_4	7.5	17.8	Prokaryotic RING finger family 4
3	PF13765 PRY	7.5e-11	52.8	SPRY-associated domain
4	PF00622 SPRY	3.4e-07	41.8	SPRY domain
5	PF00643 zf-B_box	0.0076	27.7	B-box zinc finger
6	PF00097 zf-C3HC4	0.00011	33.3	Zinc finger, C3HC4 type (RING finger)
7	PF13923 zf-C3HC4_2	0.0016	29.5	Zinc finger, C3HC4 type (RING finger)
8	PF13920 zf-C3HC4_3	5.8e-05	34.2	Zinc finger, C3HC4 type (RING finger)
9	PF15227 zf-C3HC4_4	0.0068	27.8	zinc finger of C3HC4-type, RING
10	PF16685 zf-RING_10	4.3	18.8	zinc RING finger of MSL2
11	PF13639 zf-RING_2	0.0025	29.4	Ring finger domain
12	PF14634 zf-RING_5	0.056	24.7	zinc-RING finger domain
13	PF14835 zf-RING_6	0.18	23.0	zf-RING of BARD1-type protein
14	PF13445 zf-RING_UBOX	4e-05	34.9	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301924

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000320171	0.741	Pyruvate kinase PKM
2	9606.ENSP00000294600	0.636	Coiled-coil domain containing 27
3	9606.ENSP00000369399	0.583	Sodium bicarbonate transporter-like protein 11
4	9606.ENSP00000313936	0.556	Olfactory receptor 2AE1
5	9606.ENSP00000397073	0.542	Tripartite motif-containing protein 10
6	9606.ENSP00000228495	0.539	BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 3
7	9606.ENSP00000430493	0.524	CCR4-NOT transcription complex subunit 8
8	9606.ENSP00000461386	0.506	Tripartite motif-containing protein 16-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.429	identical protein binding
GO:0003824	0.387	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0050896	0.969	response to stimulus
GO:0048519	0.966	negative regulation of biological process
GO:0048518	0.964	positive regulation of biological process
GO:0048523	0.923	negative regulation of cellular process
GO:0006950	0.922	response to stress
GO:0048522	0.907	positive regulation of cellular process
GO:0009987	0.894	cellular process
GO:0043067	0.876	regulation of programmed cell death
GO:0010942	0.825	positive regulation of cell death
GO:0006952	0.796	defense response
GO:0043068	0.791	positive regulation of programmed cell death
GO:0009607	0.786	response to biotic stimulus
GO:0044419	0.776	biological process involved in interspecies interaction between organisms
GO:0042981	0.673	regulation of apoptotic process
GO:0002376	0.551	immune system process
GO:0051707	0.526	response to other organism
GO:0098542	0.512	defense response to other organism
GO:0043065	0.511	positive regulation of apoptotic process
GO:0019222	0.480	regulation of metabolic process
GO:0060255	0.473	regulation of macromolecule metabolic process
GO:0006955	0.466	immune response
GO:0031323	0.435	regulation of cellular metabolic process
GO:0009615	0.406	response to virus
GO:0080090	0.403	regulation of primary metabolic process
GO:0140546	0.398	defense response to symbiont
GO:0045087	0.377	innate immune response
GO:0051171	0.363	regulation of nitrogen compound metabolic process
GO:0010468	0.326	regulation of gene expression
GO:0019219	0.303	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	0.999	intracellular organelle
GO:0043227	0.995	membrane-bounded organelle
GO:0043231	0.992	intracellular membrane-bounded organelle
GO:0005634	0.944	nucleus
GO:0005829	0.692	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]