StarFunc result for job id Q9UPQ7

User Input

>input (1066 residues)
MGFELDRFDGDVDPDLKCALCHKVLEDPLTTPCGHVFCAGCVLPWVVQEGSCPARCRGRL
SAKELNHVLPLKRLILKLDIKCAYATRGCGRVVKLQQLPEHLERCDFAPARCRHAGCGQV
LLRRDVEAHMRDACDARPVGRCQEGCGLPLTHGEQRAGGHCCARALRAHNGALQARLGAL
HKALKKEALRAGKREKSLVAQLAAAQLELQMTALRYQKKFTEYSARLDSLSRCVAAPPGG
KGEETKSLTLVLHRDSGSLGFNIIGGRPSVDNHDGSSSEGIFVSKIVDSGPAAKEGGLQI
HDRIIEVNGRDLSRATHDQAVEAFKTAKEPIVVQVLRRTPRTKMFTPPSESQLVDTGTQT
DITFEHIMALTKMSSPSPPVLDPYLLPEEHPSAHEYYDPNDYIGDIHQEMDREELELEEV
DLYRMNSQDKLGLTVCYRTDDEDDIGIYISEIDPNSIAAKDGRIREGDRIIQINGIEVQN
REEAVALLTSEENKNFSLLIARPELQLDEGWMDDDRNDFLDDLHMDMLEEQHHQAMQFTA
SVLQQKKHDEDGGTTDTATILSNQHEKDSGVGRTDESTRNDESSEQENNGDDATASSNPL
AGQRKLTCSQDTLGSGDLPFSNESFISADCTDADYLGIPVDECERFRELLELKCQVKSAT
PYGLYYPSGPLDAGKSDPESVDKELELLNEELRSIELECLSIVRAHKMQQLKEQYRESWM
LHNSGFRNYNTSIDVRRHELSDITELPEKSDKDSSSAYNTGESCRSTPLTLEISPDNSLR
RAAEGISCPSSEGAVGTTEAYGPASKNLLSITEDPEVGTPTYSPSLKELDPNQPLESKER
RASDGSRSPTPSQKLGSAYLPSYHHSPYKHAHIPAHAQHYQSYMQLIQQKSAVEYAQSQM
SLVSMCKDLSSPTPSEPRMEWKVKIRSDGTRYITKRPVRDRLLRERALKIREERSGMTTD
DDAVSEMKMGRYWSKEERKQHLVKAKEQRRRREFMMQSRLDCLKEQQAADDRKEMNILEL
SHKKMMKKRNKKIFDNWMTIQELLTHGTKSPDGTRVYNSFLSVTTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q69ZS0	0.337	0.338	0.000	1063	0.945	0.947	Q69ZS0.pdb.gz	PZRN3_MOUSE E3 ubiquitin-protein ligase PDZRN3 OS=Mus musculus OX=10090 GN=Pdzrn3 PE=1 SV=3
2	AFDB:Q17353	0.100	0.079	2.643E-13	1379	0.108	0.083	Q17353.pdb.gz	PAR3_CAEEL Partitioning defective protein 3 OS=Caenorhabditis elegans OX=6239 GN=par-3 PE=1 SV=1
3	PDB:2xkxA	0.085	0.124	6.309E-12	721	0.059	0.087	2xkxA.pdb.gz
4	AFDB:E9Q9R9	0.096	0.062	1.409E-9	1921	0.109	0.060	E9Q9R9.pdb.gz	DLG5_MOUSE Disks large homolog 5 OS=Mus musculus OX=10090 GN=Dlg5 PE=1 SV=1
5	AFDB:A0A2R8QMK9	0.087	0.060	1.491E-9	1689	0.079	0.050	A0A2R8QMK9.pdb.gz
6	AFDB:P39447	0.089	0.057	2.240E-8	1745	0.081	0.049	P39447.pdb.gz	ZO1_MOUSE Tight junction protein ZO-1 OS=Mus musculus OX=10090 GN=Tjp1 PE=1 SV=2
7	PDB:7pc3A	0.080	0.202	1.247E-6	405	0.031	0.081	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
8	PDB:7p73A	0.082	0.204	1.851E-6	420	0.033	0.083	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
9	PDB:6t36A	0.079	0.795	6.782E-6	93	0.029	0.333	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
10	PDB:5n7dA	0.080	0.194	2.782E-5	423	0.025	0.064	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
11	PDB:7qqmA	0.074	0.184	2.782E-5	413	0.024	0.063	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
12	PDB:7p70A	0.078	0.195	4.624E-5	407	0.029	0.076	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
13	PDB:5dkaA	0.072	0.615	8.604E-5	96	0.024	0.271	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
14	PDB:7pc5A	0.077	0.198	1.277E-4	405	0.027	0.072	7pc5A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
15	PDB:7pcbA	0.076	0.183	1.352E-4	415	0.024	0.063	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
16	AFDB:O94972	0.072	0.077	6.138E-4	964	0.132	0.146	O94972.pdb.gz	TRI37_HUMAN E3 ubiquitin-protein ligase TRIM37 OS=Homo sapiens OX=9606 GN=TRIM37 PE=1 SV=2
17	AFDB:Q9JIS1	0.080	0.057	7.693E-4	1555	0.087	0.060	Q9JIS1.pdb.gz	RIMS2_RAT Regulating synaptic membrane exocytosis protein 2 OS=Rattus norvegicus OX=10116 GN=Rims2 PE=1 SV=1
18	AFDB:D3YZU1	0.076	0.043	1.020E-3	2167	0.092	0.045	D3YZU1.pdb.gz	SHAN1_MOUSE SH3 and multiple ankyrin repeat domains protein 1 OS=Mus musculus OX=10090 GN=Shank1 PE=1 SV=1
19	AFDB:F1R7D1	0.076	0.069	1.079E-3	1173	0.112	0.101	F1R7D1.pdb.gz
20	AFDB:Q8WX93	0.054	0.044	1.279E-3	1383	0.086	0.067	Q8WX93.pdb.gz	PALLD_HUMAN Palladin OS=Homo sapiens OX=9606 GN=PALLD PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q17RL8	0.0	689	775	0.365	0.502	Q17RL8_HUMAN HCG2004980, isoform CRA_e OS=Homo sapiens OX=9606 GN=PDZD4 PE=1 SV=1
2	Q69ZS0	0.0	2007	1063	0.946	0.948	PZRN3_MOUSE E3 ubiquitin-protein ligase PDZRN3 OS=Mus musculus OX=10090 GN=Pdzrn3 PE=1 SV=3
3	Q6ZMN7	0.0	1085	1036	0.574	0.591	PZRN4_HUMAN PDZ domain-containing RING finger protein 4 OS=Homo sapiens OX=9606 GN=PDZRN4 PE=1 SV=3
4	Q8BH75	2.24e-21	98.6	317	0.065	0.218	RNF41_MOUSE E3 ubiquitin-protein ligase NRDP1 OS=Mus musculus OX=10090 GN=Rnf41 PE=1 SV=1
5	Q9H4P4	2.97e-21	98.2	317	0.065	0.218	RNF41_HUMAN E3 ubiquitin-protein ligase NRDP1 OS=Homo sapiens OX=9606 GN=RNF41 PE=1 SV=2
6	Q9CQ29	1.28e-19	91.7	239	0.053	0.234	RN151_MOUSE RING finger protein 151 OS=Mus musculus OX=10090 GN=Rnf151 PE=1 SV=1
7	Q7ZW16	2.37e-19	92.4	318	0.062	0.208	RNF41_DANRE E3 ubiquitin-protein ligase NRDP1 OS=Danio rerio OX=7955 GN=rnf41 PE=2 SV=1
8	Q2KHN1	4.14e-19	90.1	245	0.053	0.229	RN151_HUMAN RING finger protein 151 OS=Homo sapiens OX=9606 GN=RNF151 PE=1 SV=1
9	Q9VUV7	4.80e-18	88.6	315	0.061	0.206	Q9VUV7_DROME E3 ubiquitin-protein ligase NRDP1 OS=Drosophila melanogaster OX=7227 GN=elgi PE=2 SV=1
10	Q8VBX6	3.03e-16	87.0	2055	0.072	0.037	MPDZ_MOUSE Multiple PDZ domain protein OS=Mus musculus OX=10090 GN=Mpdz PE=1 SV=2
11	Q4H4B6	3.16e-16	86.7	1724	0.072	0.045	SCRIB_DANRE Protein scribble homolog OS=Danio rerio OX=7955 GN=scrib PE=1 SV=1
12	Q80U72	3.74e-16	86.7	1612	0.072	0.048	SCRIB_MOUSE Protein scribble homolog OS=Mus musculus OX=10090 GN=Scrib PE=1 SV=2
13	A0A8I6APB3	6.16e-16	85.9	1610	0.072	0.048	A0A8I6APB3_RAT Scribble planar cell polarity protein OS=Rattus norvegicus OX=10116 GN=Scrib PE=1 SV=1
14	D3ZWS0	6.19e-16	85.9	1638	0.072	0.047	D3ZWS0_RAT Scribble planar cell polarity protein OS=Rattus norvegicus OX=10116 GN=Scrib PE=1 SV=2
15	F1MAD2	6.28e-16	85.9	1836	0.071	0.041	INADL_RAT InaD-like protein OS=Rattus norvegicus OX=10116 GN=Patj PE=1 SV=2
16	A0A8I6ABB5	8.92e-16	85.1	1589	0.072	0.048	A0A8I6ABB5_RAT Scribble planar cell polarity protein OS=Rattus norvegicus OX=10116 GN=Scrib PE=1 SV=1
17	A0A8I6ANK4	1.43e-15	84.7	1589	0.071	0.048	A0A8I6ANK4_RAT Scribble planar cell polarity protein OS=Rattus norvegicus OX=10116 GN=Scrib PE=1 SV=1
18	Q8MR31	2.01e-15	83.6	767	0.043	0.060	SLIP1_DROME Slo-interacting protein 1 OS=Drosophila melanogaster OX=7227 GN=Slip1 PE=1 SV=2
19	A0A669KB89	2.74e-15	83.6	1658	0.095	0.061	A0A669KB89_HUMAN Scribble planar cell polarity protein OS=Homo sapiens OX=9606 GN=SCRIB PE=1 SV=1
20	Q92796	3.19e-15	83.2	817	0.067	0.087	DLG3_HUMAN Disks large homolog 3 OS=Homo sapiens OX=9606 GN=DLG3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00595 PDZ	4e-28	108.9	PDZ domain
2	PF13180 PDZ_2	6.3e-11	53.8	PDZ domain
3	PF17820 PDZ_6	1e-17	75.1	PDZ domain
4	PF02163 Peptidase_M50	1.5e-07	42.6	Peptidase family M50
5	PF14447 Prok-RING_4	0.32	22.2	Prokaryotic RING finger family 4
6	PF03145 Sina	0.026	26.1	Seven in absentia protein family
7	PF14685 Tricorn_PDZ	44	15.5	Tricorn protease PDZ domain
8	PF00097 zf-C3HC4	0.0095	27.1	Zinc finger, C3HC4 type (RING finger)
9	PF13923 zf-C3HC4_2	1.5e-05	36.0	Zinc finger, C3HC4 type (RING finger)
10	PF13920 zf-C3HC4_3	0.012	26.7	Zinc finger, C3HC4 type (RING finger)
11	PF15227 zf-C3HC4_4	0.34	22.4	zinc finger of C3HC4-type, RING
12	PF13639 zf-RING_2	0.015	27.0	Ring finger domain
13	PF14634 zf-RING_5	0.28	22.5	zinc-RING finger domain
14	PF14835 zf-RING_6	9.5e+02	11.1	zf-RING of BARD1-type protein
15	PF13445 zf-RING_UBOX	0.025	25.9	RING-type zinc-finger
16	PF02176 zf-TRAF	0.026	26.5	TRAF-type zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263666

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363571	0.838	Muscle, skeletal receptor tyrosine-protein kinase
2	9606.ENSP00000397259	0.698	Ataxin-7-like protein 3
3	9606.ENSP00000315182	0.694	Protein SHQ1 homolog
4	9606.ENSP00000402505	0.689	C3 and PZP like, alpha-2-macroglobulin domain containing 8
5	9606.ENSP00000217173	0.687	RING finger protein 37
6	9606.ENSP00000386722	0.687	FCH and double SH3 domains 2
7	9606.ENSP00000285737	0.674	Lon protease homolog 2, peroxisomal
8	9606.ENSP00000313759	0.672	CST complex subunit CTC1
9	9606.ENSP00000256707	0.653	Kinase D-interacting substrate of 220 kDa
10	9606.ENSP00000381717	0.643	Ubiquitin-conjugating enzyme E2 D2
11	9606.ENSP00000262648	0.636	Anosmin-1
12	9606.ENSP00000340271	0.635	Transcription initiation factor TFIID subunit 3
13	9606.ENSP00000472808	0.609	Zinc finger protein 473
14	9606.ENSP00000337618	0.606	Magnesium transporter NIPA2
15	9606.ENSP00000345295	0.606	SH2 domain containing 4B
16	9606.ENSP00000282344	0.601	Ubiquitin carboxyl-terminal hydrolase 12
17	9606.ENSP00000296088	0.599	SNF-related serine/threonine-protein kinase
18	9606.ENSP00000445340	0.590	Sodium-coupled monocarboxylate transporter 1
19	9606.ENSP00000272643	0.565	Thrombospondin type-1 domain-containing protein 7B
20	9606.ENSP00000263925	0.537	E3 ubiquitin-protein ligase LNX

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061630	0.998	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0008152	0.955	metabolic process
GO:0071704	0.946	organic substance metabolic process
GO:0044238	0.934	primary metabolic process
GO:0036211	0.902	protein modification process
GO:0070647	0.884	protein modification by small protein conjugation or removal
GO:0071840	0.865	cellular component organization or biogenesis
GO:0016043	0.859	cellular component organization
GO:0050789	0.749	regulation of biological process
GO:0007528	0.708	neuromuscular junction development
GO:0032446	0.708	protein modification by small protein conjugation
GO:0050794	0.705	regulation of cellular process
GO:0016567	0.414	protein ubiquitination
GO:0044237	0.412	cellular metabolic process
GO:0048518	0.333	positive regulation of biological process
GO:0050896	0.329	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030054	0.998	cell junction
GO:0045202	0.940	synapse
GO:0016020	0.869	membrane
GO:0005622	0.850	intracellular anatomical structure
GO:0043226	0.822	organelle
GO:0071944	0.794	cell periphery
GO:0043227	0.793	membrane-bounded organelle
GO:0043231	0.775	intracellular membrane-bounded organelle
GO:0005737	0.749	cytoplasm
GO:0031594	0.737	neuromuscular junction
GO:0005886	0.704	plasma membrane
GO:0032991	0.650	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]