StarFunc result for job id Q9UPQ9

User Input

>input (1833 residues)
MREKEQEREEQLMEDKKRKKEDKKKKEATQKVTEQKTKVPEVTKPSLSQPTAASPIGSSP
SPPVNGGNNAKRVAVPNGQPPSAARYMPREVPPRFRCQQDHKVLLKRGQPPPPSCMLLGG
GAGPPPCTAPGANPNNAQVTGALLQSESGTAPDSTLGGAAASNYANSTWGSGASSNNGTS
PNPIHIWDKVIVDGSDMEEWPCIASKDTESSSENTTDNNSASNPGSEKSTLPGSTTSNKG
KGSQCQSASSGNECNLGVWKSDPKAKSVQSSNSTTENNNGLGNWRNVSGQDRIGPGSGFS
NFNPNSNPSAWPALVQEGTSRKGALETDNSNSSAQVSTVGQTSREQQSKMENAGVNFVVS
GREQAQIHNTDGPKNGNTNSLNLSSPNPMENKGMPFGMGLGNTSRSTDAPSQSTGDRKTG
SVGSWGAARGPSGTDTVSGQSNSGNNGNNGKEREDSWKGASVQKSTGSKNDSWDNNNRST
GGSWNFGPQDSNDNKWGEGNKMTSGVSQGEWKQPTGSDELKIGEWSGPNQPNSSTGAWDN
QKGHPLPENQGNAQAPCWGRSSSSTGSEVGGQSTGSNHKAGSSDSHNSGRRSYRPTHPDC
QAVLQTLLSRTDLDPRVLSNTGWGQTQIKQDTVWDIEEVPRPEGKSDKGTEGWESAATQT
KNSGGWGDAPSQSNQMKSGWGELSASTEWKDPKNTGGWNDYKNNNSSNWGGGRPDEKTPS
SWNENPSKDQGWGGGRQPNQGWSSGKNGWGEEVDQTKNSNWESSASKPVSGWGEGGQNEI
GTWGNGGNASLASKGGWEDCKRSPAWNETGRQPNSWNKQHQQQQPPQQPPPPQPEASGSW
GGPPPPPPGNVRPSNSSWSSGPQPATPKDEEPSGWEEPSPQSISRKMDIDDGTSAWGDPN
SYNYKNVNLWDKNSQGGPAPREPNLPTPMTSKSASVWSKSTPPAPDNGTSAWGEPNESSP
GWGEMDDTGASTTGWGNTPANAPNAMKPNSKSMQDGWGESDGPVTGARHPSWEEEEDGGV
WNTTGSQGSASSHNSASWGQGGKKQMKCSLKGGNNDSWMNPLAKQFSNMGLLSQTEDNPS
SKMDLSVGSLSDKKFDVDKRAMNLGDFNDIMRKDRSGFRPPNSKDMGTTDSGPYFEKLTL
PFSNQDGCLGDEAPCSPFSPSPSYKLSPSGSTLPNVSLGAIGTGLNPQNFAARQGGSHGL
FGNSTAQSRGLHTPVQPLNSSPSLRAQVPPQFISPQVSASMLKQFPNSGLSPGLFNVGPQ
LSPQQIAMLSQLPQIPQFQLACQLLLQQQQQQQLLQNQRKISQAVRQQQEQQLARMVSAL
QQQQQQQQRQPGMKHSPSHPVGPKPHLDNMVPNALNVGLPDLQTKGPIPGYGSGFSSGGM
DYGMVGGKEAGTESRFKQWTSMMEGLPSVATQEANMHKNGAIVAPGKTRGGSPYNQFDII
PGDTLGGHTGPAGDSWLPAKSPPTNKIGSKSSNASWPPEFQPGVPWKGIQNIDPESDPYV
TPGSVLGGTATSPIVDTDHQLLRDNTTGSNSSLNTSLPSPGAWPYSASDNSFTNVHSTSA
KFPDYKSTWSPDPIGHNPTHLSNKMWKNHISSRNTTPLPRPPPGLTNPKPSSPWSSTAPR
SVRGWGTQDSRLASASTWSDGGSVRPSYWLVLHNLTPQIDGSTLRTICMQHGPLLTFHLN
LTQGTALIRYSTKQEAAKAQTALHMCVLGNTTILAEFATDDEVSRFLAQAQPPTPAATPS
APAAGWQSLETGQNQSDPVGPALNLFGGSTGLGQWSSSAGGSSGADLAGASLWGPPNYSS
SLWGVPTVEDPHRMGSPAPLLPGDLLGGGSDSI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1LV37	0.154	0.154	0.000	1818	0.927	0.935	F1LV37.pdb.gz	F1LV37_RAT Trinucleotide repeat containing adaptor 6B OS=Rattus norvegicus OX=10116 GN=Tnrc6b PE=1 SV=3
2	AFDB:Q9UPQ9	0.999	0.999	0.000	1833	1.000	1.000	Q9UPQ9.pdb.gz	TNR6B_HUMAN Trinucleotide repeat-containing gene 6B protein OS=Homo sapiens OX=9606 GN=TNRC6B PE=1 SV=4
3	AFDB:Q8NDV7	0.093	0.090	2.047E-64	1962	0.399	0.373	Q8NDV7.pdb.gz	TNR6A_HUMAN Trinucleotide repeat-containing gene 6A protein OS=Homo sapiens OX=9606 GN=TNRC6A PE=1 SV=2
4	AFDB:Q3UHK8	0.084	0.082	2.502E-63	1896	0.389	0.376	Q3UHK8.pdb.gz	TNR6A_MOUSE Trinucleotide repeat-containing gene 6A protein OS=Mus musculus OX=10090 GN=Tnrc6a PE=1 SV=2
5	AFDB:D3ZRA6	0.084	0.089	2.763E-52	1683	0.348	0.378	D3ZRA6.pdb.gz	D3ZRA6_RAT Trinucleotide repeat containing adaptor 6C OS=Rattus norvegicus OX=10116 GN=Tnrc6c PE=1 SV=4
6	AFDB:Q8SY33	0.061	0.079	8.102E-23	1384	0.176	0.233	Q8SY33.pdb.gz	GAWKY_DROME Protein Gawky OS=Drosophila melanogaster OX=7227 GN=gw PE=1 SV=1
7	AFDB:Q96EV2	0.064	0.095	5.005E-8	1170	0.098	0.154	Q96EV2.pdb.gz	RBM33_HUMAN RNA-binding protein 33 OS=Homo sapiens OX=9606 GN=RBM33 PE=1 SV=3
8	AFDB:Q9UKV3	0.049	0.066	2.964E-7	1341	0.089	0.122	Q9UKV3.pdb.gz	ACINU_HUMAN Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1 PE=1 SV=2
9	PDB:7r5jF0	0.043	0.285	1.109E-6	241	0.016	0.124	7r5jF0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
10	PDB:6ff7X	0.043	0.405	4.140E-6	171	0.009	0.094	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
11	PDB:3lqvB	0.043	0.604	4.422E-6	115	0.010	0.157	3lqvB.pdb.gz	Branch Recognition by SF3b14
12	AFDB:Q9JIX8	0.046	0.063	6.554E-6	1338	0.094	0.129	Q9JIX8.pdb.gz	ACINU_MOUSE Apoptotic chromatin condensation inducer in the nucleus OS=Mus musculus OX=10090 GN=Acin1 PE=1 SV=3
13	PDB:7oqcF	0.048	0.291	1.041E-5	267	0.008	0.052	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
14	PDB:1hl6A	0.040	0.563	1.112E-5	119	0.011	0.168	1hl6A.pdb.gz
15	PDB:5xjcw	0.040	0.723	2.012E-5	91	0.010	0.209	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
16	PDB:6exnY	0.040	0.728	2.012E-5	87	0.010	0.207	6exnY.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
17	PDB:7dvqY	0.042	0.480	2.987E-5	140	0.009	0.114	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
18	PDB:6y53o	0.037	0.396	3.408E-5	160	0.008	0.087	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
19	PDB:3pgwP	0.044	0.595	4.435E-5	113	0.009	0.142	3pgwP.pdb.gz
20	AFDB:M9NFI9	0.036	0.031	7.043E-4	2148	0.144	0.123	M9NFI9.pdb.gz	M9NFI9_DROME Spinophilin, isoform J OS=Drosophila melanogaster OX=7227 GN=Spn PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JZJ3	0.0	790	1926	0.400	0.381	A0A0G2JZJ3_RAT Trinucleotide repeat containing adaptor 6A OS=Rattus norvegicus OX=10116 GN=Tnrc6a PE=1 SV=2
2	D3ZRA6	0.0	740	1901	0.405	0.390	D3ZRA6_RAT Trinucleotide repeat containing adaptor 6C OS=Rattus norvegicus OX=10116 GN=Tnrc6c PE=1 SV=4
3	F1LV37	0.0	2831	1765	0.877	0.910	F1LV37_RAT Trinucleotide repeat containing adaptor 6B OS=Rattus norvegicus OX=10116 GN=Tnrc6b PE=1 SV=3
4	Q3UHC0	0.0	625	1690	0.348	0.378	TNR6C_MOUSE Trinucleotide repeat-containing gene 6C protein OS=Mus musculus OX=10090 GN=Tnrc6c PE=1 SV=2
5	Q3UHK8	0.0	743	1896	0.396	0.382	TNR6A_MOUSE Trinucleotide repeat-containing gene 6A protein OS=Mus musculus OX=10090 GN=Tnrc6a PE=1 SV=2
6	Q8NDV7	0.0	814	1962	0.418	0.391	TNR6A_HUMAN Trinucleotide repeat-containing gene 6A protein OS=Homo sapiens OX=9606 GN=TNRC6A PE=1 SV=2
7	Q9HCJ0	0.0	625	1690	0.350	0.379	TNR6C_HUMAN Trinucleotide repeat-containing gene 6C protein OS=Homo sapiens OX=9606 GN=TNRC6C PE=1 SV=3
8	Q9UPQ9	0.0	3665	1833	1.000	1.000	TNR6B_HUMAN Trinucleotide repeat-containing gene 6B protein OS=Homo sapiens OX=9606 GN=TNRC6B PE=1 SV=4
9	H7C269	2.20e-37	155	906	0.068	0.137	H7C269_HUMAN Trinucleotide repeat containing adaptor 6A (Fragment) OS=Homo sapiens OX=9606 GN=TNRC6A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10427 Ago_hook	4.6e-17	74.5	Argonaute hook
2	PF00076 RRM_1	9.2	17.5	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF16842 RRM_occluded	0.47	21.7	Occluded RNA-recognition motif
4	PF16608 TNRC6-PABC_bdg	4.6e-101	349.8	TNRC6-PABC binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000401946

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000220592	0.990	Protein argonaute-2
2	9606.ENSP00000362300	0.975	Protein argonaute-1
3	9606.ENSP00000362287	0.971	Protein argonaute-3
4	9606.ENSP00000399797	0.968	Putative helicase MOV-10
5	9606.ENSP00000362306	0.942	Protein argonaute-4
6	9606.ENSP00000312379	0.926	Histone-lysine N-methyltransferase 2E
7	9606.ENSP00000361021	0.919	Phosphatase and tensin homolog
8	9606.ENSP00000262189	0.918	Histone-lysine N-methyltransferase 2C
9	9606.ENSP00000479618	0.912	Myc proto-oncogene protein
10	9606.ENSP00000263253	0.911	Histone acetyltransferase p300
11	9606.ENSP00000436786	0.911	Histone-lysine N-methyltransferase 2A
12	9606.ENSP00000269305	0.909	Cellular tumor antigen p53
13	9606.ENSP00000483667	0.909	Chromodomain-helicase-DNA-binding protein 1
14	9606.ENSP00000395535	0.907	Methyl-CpG-binding protein 2
15	9606.ENSP00000398837	0.907	Histone-lysine N-methyltransferase 2B
16	9606.ENSP00000370896	0.906	Protein GREB1
17	9606.ENSP00000301067	0.905	Histone-lysine N-methyltransferase 2D
18	9606.ENSP00000263754	0.904	Histone acetyltransferase KAT2B
19	9606.ENSP00000277541	0.903	Neurogenic locus notch homolog protein 1
20	9606.ENSP00000351446	0.903	WD repeat-containing protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0080090	0.993	regulation of primary metabolic process
GO:0051171	0.992	regulation of nitrogen compound metabolic process
GO:0010468	0.992	regulation of gene expression
GO:0009889	0.986	regulation of biosynthetic process
GO:0031324	0.985	negative regulation of cellular metabolic process
GO:0035195	0.984	miRNA-mediated gene silencing
GO:0048518	0.983	positive regulation of biological process
GO:0017148	0.982	negative regulation of translation
GO:0048522	0.971	positive regulation of cellular process
GO:0009893	0.967	positive regulation of metabolic process
GO:0043488	0.957	regulation of mRNA stability
GO:0010604	0.951	positive regulation of macromolecule metabolic process
GO:0031325	0.948	positive regulation of cellular metabolic process
GO:0061014	0.943	positive regulation of mRNA catabolic process
GO:0009987	0.869	cellular process
GO:0050896	0.389	response to stimulus
GO:0008152	0.348	metabolic process
GO:0071704	0.325	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0070013	0.455	intracellular organelle lumen
GO:0032991	0.451	protein-containing complex
GO:0031981	0.448	nuclear lumen
GO:0005654	0.407	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]