StarFunc result for job id Q9UPR0

User Input

>input (1127 residues)
MAECGRGGAAGGALPTSPGPALGAKGALKAGVGEGGGGGGRLGHGRARYDSGGVSNGDCS
LGVSGDEARASPTRGPRGVALAPTPSAVVCTLPRESKPGGLPRRSSIIKDGTKQKRERKK
TVSFSSMPTEKKISSASDCINSMVEGSELKKVRSNSRIYHRYFLLDADMQSLRWEPSKKD
SEKAKIDIKSIKEVRTGKNTDIFRSNGISDQISEDCAFSVIYGENYESLDLVANSADVAN
IWVTGLRYLISYGKHTLDMLESSQDNMRTSWVSQMFSEIDVDNLGHITLCNAVQCIRNLN
PGLKTSKIELKFKELHKSKDKAGTEVTKEEFIEVFHELCTRPEIYFLLVQFSSNKEFLDT
KDLMMFLEAEQGVAHINEEISLEIIHKYEPSKEGQEKGWLSIDGFTNYLMSPDCYIFDPE
HKKVCQDMKQPLSHYFINSSHNTYLIEDQFRGPSDITGYIRALKMGCRSVELDVWDGPDN
EPVIYTGHTMTSQIVFRSVIDIINKYAFFASEYPLILCLENHCSIKQQKVMVQHMKKLLG
DKLYTTSPNVEESYLPSPDVLKGKILIKAKKLSSNCSGVEGDVTDEDEGAEMSQRMGKEN
MEQPNNVPVKRFQLCKELSELVSICKSVQFKEFQVSFQVQKYWEVCSFNEVLASKYANEN
PGDFVNYNKRFLARVFPSPMRIDSSNMNPQDFWKCGCQIVAMNFQTPGLMMDLNIGWFRQ
NGNCGYVLRPAIMREEVSFFSANTKDSVPGVSPQLLHIKIISGQNFPKPKGSGAKGDVVD
PYVYVEIHGIPADCAEQRTKTVHQNGDAPIFDESFEFQINLPELAMVRFVVLDDDYIGDE
FIGQYTIPFECLQTGYRHVPLQSLTGEVLAHASLFVHVAITNRRGGGKPHKRGLSVRKGK
KSREYASLRTLWIKTVDEVFKNAQPPIRDATDLRENMQNAVVSFKELCGLSSVANLMQCM
LAVSPRFLGPDNTPLVVLNLSEQYPTMELQGIVPEVLKKIVTTYDMMIQSLKALIENADA
VYEKIVHCQKAAMEFHEHLHSIGTKEGLKERKLQKAVESFTWNITILKGQADLLKYAKNE
TLENLKQIHFAAVSCGLNKPGTENADVQKPRRSLEVIPEKANDETGE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3USB7	0.867	0.891	0.000	1096	0.596	0.613	Q3USB7.pdb.gz	PLCL1_MOUSE Inactive phospholipase C-like protein 1 OS=Mus musculus OX=10090 GN=Plcl1 PE=1 SV=3
2	AFDB:Q8K394	0.938	0.938	0.000	1128	0.968	0.967	Q8K394.pdb.gz	PLCL2_MOUSE Inactive phospholipase C-like protein 2 OS=Mus musculus OX=10090 GN=Plcl2 PE=1 SV=2
3	AFDB:A2AP18	0.477	0.362	4.407E-77	1501	0.309	0.232	A2AP18.pdb.gz	PLCH2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Mus musculus OX=10090 GN=Plch2 PE=1 SV=2
4	AFDB:Q9BRC7	0.482	0.698	5.041E-73	762	0.256	0.379	Q9BRC7.pdb.gz	PLCD4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Homo sapiens OX=9606 GN=PLCD4 PE=1 SV=1
5	AFDB:F1QJ13	0.476	0.684	1.915E-72	769	0.261	0.382	F1QJ13.pdb.gz	F1QJ13_DANRE Phosphoinositide phospholipase C OS=Danio rerio OX=7955 GN=plcd3b PE=4 SV=1
6	AFDB:C9JEA7	0.474	0.661	4.439E-72	794	0.262	0.372	C9JEA7.pdb.gz	C9JEA7_HUMAN Phosphoinositide phospholipase C OS=Homo sapiens OX=9606 GN=PLCD4 PE=1 SV=1
7	AFDB:Q4KWH5	0.479	0.326	1.193E-71	1682	0.273	0.183	Q4KWH5.pdb.gz	PLCH1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Mus musculus OX=10090 GN=Plch1 PE=2 SV=1
8	AFDB:Q62711	0.475	0.679	1.193E-71	772	0.257	0.376	Q62711.pdb.gz	PLCD4_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Rattus norvegicus OX=10116 GN=Plcd4 PE=1 SV=1
9	AFDB:Q8K3R3	0.474	0.652	1.528E-71	807	0.257	0.359	Q8K3R3.pdb.gz	PLCD4_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Mus musculus OX=10090 GN=Plcd4 PE=1 SV=2
10	AFDB:D4A978	0.469	0.660	1.236E-67	788	0.242	0.346	D4A978.pdb.gz	D4A978_RAT Phosphoinositide phospholipase C OS=Rattus norvegicus OX=10116 GN=Plcd3 PE=1 SV=2
11	PDB:4gnkB	0.441	0.636	5.066E-55	769	0.210	0.308	4gnkB.pdb.gz	Full-length G alpha (q)-phospholipase C-beta 3 structure reveals interfaces of the C-terminal coiled-coil domain.
12	PDB:1cjyA	0.107	0.184	5.924E-8	633	0.043	0.076	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
13	PDB:5ixcA	0.099	0.161	1.402E-6	684	0.019	0.031	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
14	PDB:5izrC	0.099	0.166	2.538E-6	659	0.019	0.032	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
15	PDB:5iz5B	0.102	0.152	5.071E-6	746	0.023	0.035	5iz5B.pdb.gz
16	PDB:4rj9A	0.098	0.621	6.823E-6	161	0.020	0.137	4rj9A.pdb.gz
17	PDB:5iz5A	0.098	0.145	7.914E-6	757	0.023	0.034	5iz5A.pdb.gz
18	PDB:5a52A	0.091	0.611	2.235E-5	154	0.022	0.162	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
19	PDB:3nsjA	0.088	0.181	3.665E-5	530	0.023	0.049	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
20	PDB:4yknA	0.091	0.085	4.046E-5	1205	0.045	0.042	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15111	0.0	1439	1095	0.633	0.651	PLCL1_HUMAN Inactive phospholipase C-like protein 1 OS=Homo sapiens OX=9606 GN=PLCL1 PE=1 SV=3
2	Q3USB7	0.0	1424	1096	0.617	0.634	PLCL1_MOUSE Inactive phospholipase C-like protein 1 OS=Mus musculus OX=10090 GN=Plcl1 PE=1 SV=3
3	Q62688	0.0	1424	1096	0.618	0.636	PLCL1_RAT Inactive phospholipase C-like protein 1 OS=Rattus norvegicus OX=10116 GN=Plcl1 PE=1 SV=1
4	Q8K394	0.0	2274	1128	0.968	0.967	PLCL2_MOUSE Inactive phospholipase C-like protein 2 OS=Mus musculus OX=10090 GN=Plcl2 PE=1 SV=2
5	Q9UPR0	0.0	2353	1127	1.000	1.000	PLCL2_HUMAN Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2 PE=1 SV=2
6	F1Q5G9	2.84e-174	533	761	0.272	0.403	F1Q5G9_DANRE Phosphoinositide phospholipase C OS=Danio rerio OX=7955 GN=plcd4a PE=4 SV=1
7	Q9BRC7	1.24e-165	510	762	0.257	0.381	PLCD4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Homo sapiens OX=9606 GN=PLCD4 PE=1 SV=1
8	C9JEA7	1.12e-163	506	794	0.257	0.365	C9JEA7_HUMAN Phosphoinositide phospholipase C OS=Homo sapiens OX=9606 GN=PLCD4 PE=1 SV=1
9	Q62711	5.87e-159	493	772	0.260	0.380	PLCD4_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Rattus norvegicus OX=10116 GN=Plcd4 PE=1 SV=1
10	P10688	6.60e-156	484	756	0.257	0.384	PLCD1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Rattus norvegicus OX=10116 GN=Plcd1 PE=1 SV=1
11	Q8R3B1	6.20e-153	476	756	0.256	0.382	PLCD1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Mus musculus OX=10090 GN=Plcd1 PE=1 SV=2
12	F1QJ13	9.38e-153	476	769	0.259	0.380	F1QJ13_DANRE Phosphoinositide phospholipase C OS=Danio rerio OX=7955 GN=plcd3b PE=4 SV=1
13	Q8N3E9	6.32e-150	470	789	0.247	0.352	PLCD3_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Homo sapiens OX=9606 GN=PLCD3 PE=1 SV=3
14	Q8K2J0	6.03e-148	464	785	0.246	0.353	PLCD3_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Mus musculus OX=10090 GN=Plcd3 PE=1 SV=2
15	P51178	9.01e-146	458	756	0.248	0.369	PLCD1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Homo sapiens OX=9606 GN=PLCD1 PE=1 SV=2
16	Q86YW0	2.31e-143	446	608	0.212	0.393	PLCZ1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Homo sapiens OX=9606 GN=PLCZ1 PE=1 SV=1
17	A0A8I6AGE0	9.76e-142	447	744	0.240	0.363	A0A8I6AGE0_RAT Phosphoinositide phospholipase C OS=Rattus norvegicus OX=10116 GN=Plcd3 PE=4 SV=1
18	Q8K4D7	1.57e-133	422	647	0.212	0.369	PLCZ1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Mus musculus OX=10090 GN=Plcz1 PE=1 SV=1
19	Q5FX52	2.77e-132	419	645	0.208	0.363	PLCZ1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Rattus norvegicus OX=10116 GN=Plcz1 PE=2 SV=1
20	D4A978	4.91e-123	398	762	0.229	0.339	D4A978_RAT Phosphoinositide phospholipase C OS=Rattus norvegicus OX=10116 GN=Plcd3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	1.6e-12	59.0	C2 domain
2	PF00036 EF-hand_1	5.6e+02	11.6	EF hand
3	PF13499 EF-hand_7	43	16.0	EF-hand domain pair
4	PF09279 EF-hand_like	6.1e-13	60.4	Phosphoinositide-specific phospholipase C, efhand-like
5	PF12814 Mcp5_PH	77	14.9	Meiotic cell cortex C-terminal pleckstrin homology
6	PF00169 PH	0.0056	28.5	PH domain
7	PF16457 PH_12	2.5e-18	78.3	Pleckstrin homology domain
8	PF17787 PH_14	0.0037	28.5	PH domain
9	PF00388 PI-PLC-X	2.6e-56	200.7	Phosphatidylinositol-specific phospholipase C, X domain
10	PF00387 PI-PLC-Y	5.6e-33	125.1	Phosphatidylinositol-specific phospholipase C, Y domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000478458

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326031	0.705	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
2	9606.ENSP00000341779	0.674	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
3	9606.ENSP00000479207	0.552	Inactive polypeptide N-acetylgalactosaminyltransferase-like protein 5
4	9606.ENSP00000227756	0.512	Polypeptide N-acetylgalactosaminyltransferase 18

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0050811	0.990	GABA receptor binding
GO:0042578	0.988	phosphoric ester hydrolase activity
GO:0004629	0.977	phospholipase C activity
GO:0004435	0.928	phosphatidylinositol phospholipase C activity
GO:0043167	0.662	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050789	0.990	regulation of biological process
GO:0050794	0.970	regulation of cellular process
GO:0032501	0.955	multicellular organismal process
GO:0023052	0.909	signaling
GO:0007154	0.902	cell communication
GO:0050896	0.884	response to stimulus
GO:0010646	0.869	regulation of cell communication
GO:0023051	0.862	regulation of signaling
GO:0009966	0.749	regulation of signal transduction
GO:0051716	0.745	cellular response to stimulus
GO:0048519	0.659	negative regulation of biological process
GO:0019222	0.636	regulation of metabolic process
GO:0051099	0.635	positive regulation of binding
GO:0008152	0.624	metabolic process
GO:0048856	0.610	anatomical structure development
GO:0071704	0.586	organic substance metabolic process
GO:0044238	0.572	primary metabolic process
GO:0043393	0.569	regulation of protein binding
GO:0001775	0.553	cell activation
GO:0007214	0.543	gamma-aminobutyric acid signaling pathway
GO:0032092	0.543	positive regulation of protein binding
GO:0120161	0.525	regulation of cold-induced thermogenesis
GO:1900120	0.519	regulation of receptor binding
GO:0042113	0.485	B cell activation
GO:0070661	0.434	leukocyte proliferation
GO:0044237	0.432	cellular metabolic process
GO:0030154	0.401	cell differentiation
GO:0042100	0.371	B cell proliferation
GO:0007165	0.335	signal transduction
GO:0050804	0.318	modulation of chemical synaptic transmission
GO:0048523	0.315	negative regulation of cellular process
GO:0048468	0.314	cell development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0016020	0.980	membrane
GO:0071944	0.976	cell periphery
GO:0005886	0.963	plasma membrane
GO:0043227	0.943	membrane-bounded organelle
GO:0043229	0.943	intracellular organelle
GO:0043231	0.930	intracellular membrane-bounded organelle
GO:0070013	0.880	intracellular organelle lumen
GO:0005634	0.553	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	0.988	Acting on ester bonds.
EC:3.1.4.-	0.977	Phosphoric diester hydrolases.
RHEA:33179	0.928	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+)
EC:3.1.4.11	0.928	phosphoinositide phospholipase C.

[back to server]