StarFunc result for job id Q9UPR3

User Input

>input (1016 residues)
MSQGPPTGESSEPEAKVLHTKRLYRAVVEAVHRLDLILCNKTAYQEVFKPENISLRNKLR
ELCVKLMFLHPVDYGRKAEELLWRKVYYEVIQLIKTNKKHIHSRSTLECAYRTHLVAGIG
FYQHLLLYIQSHYQLELQCCIDWTHVTDPLIGCKKPVSASGKEMDWAQMACHRCLVYLGD
LSRYQNELAGVDTELLAERFYYQALSVAPQIGMPFNQLGTLAGSKYYNVEAMYCYLRCIQ
SEVSFEGAYGNLKRLYDKAAKMYHQLKKCETRKLSPGKKRCKDIKRLLVNFMYLQSLLQP
KSSSVDSELTSLCQSVLEDFNLCLFYLPSSPNLSLASEDEEEYESGYAFLPDLLIFQMVI
ICLMCVHSLERAGSKQYSAAIAFTLALFSHLVNHVNIRLQAELEEGENPVPAFQSDGTDE
PESKEPVEKEEEPDPEPPPVTPQVGEGRKSRKFSRLSCLRRRRHPPKVGDDSDLSEGFES
DSSHDSARASEGSDSGSDKSLEGGGTAFDAETDSEMNSQESRSDLEDMEEEEGTRSPTLE
PPRGRSEAPDSLNGPLGPSEASIASNLQAMSTQMFQTKRCFRLAPTFSNLLLQPTTNPHT
SASHRPCVNGDVDKPSEPASEEGSESEGSESSGRSCRNERSIQEKLQVLMAEGLLPAVKV
FLDWLRTNPDLIIVCAQSSQSLWNRLSVLLNLLPAAGELQESGLALCPEVQDLLEGCELP
DLPSSLLLPEDMALRNLPPLRAAHRRFNFDTDRPLLSTLEESVVRICCIRSFGHFIARLQ
GSILQFNPEVGIFVSIAQSEQESLLQQAQAQFRMAQEEARRNRLMRDMAQLRLQLEVSQL
EGSLQQPKAQSAMSPYLVPDTQALCHHLPVIRQLATSGRFIVIIPRTVIDGLDLLKKEHP
GARDGIRYLEAEFKKGNRYIRCQKEVGKSFERHKLKRQDADAWTLYKILDSCKQLTLAQG
AGEEDPSGMVTIITGLPLDNPSVLSGPMQAALQAAAHASVDIKNVLDFYKQWKEIG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UPR3	1.000	1.000	0.000	1016	1.000	1.000	Q9UPR3.pdb.gz	SMG5_HUMAN Nonsense-mediated mRNA decay factor SMG5 OS=Homo sapiens OX=9606 GN=SMG5 PE=1 SV=3
2	AFDB:F1R7R1	0.769	0.716	4.332E-80	1099	0.668	0.618	F1R7R1.pdb.gz	SMG5_DANRE Nonsense-mediated mRNA decay factor SMG5 OS=Danio rerio OX=7955 GN=smg5 PE=2 SV=1
3	AFDB:Q92540	0.281	0.252	3.479E-10	1137	0.118	0.106	Q92540.pdb.gz	SMG7_HUMAN Nonsense-mediated mRNA decay factor SMG7 OS=Homo sapiens OX=9606 GN=SMG7 PE=1 SV=2
4	AFDB:O44502	0.100	0.123	1.161E-3	743	0.089	0.121	O44502.pdb.gz	COG8_CAEEL Conserved oligomeric Golgi complex subunit 8 OS=Caenorhabditis elegans OX=6239 GN=cogc-8 PE=3 SV=1
5	AFDB:Q9VS24	0.127	0.129	3.851E-3	994	0.078	0.079	Q9VS24.pdb.gz	MELT_DROME Protein melted OS=Drosophila melanogaster OX=7227 GN=melt PE=1 SV=2
6	AFDB:A0A0G2K6D0	0.096	0.076	4.644E-3	1366	0.092	0.068	A0A0G2K6D0.pdb.gz	A0A0G2K6D0_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6a PE=1 SV=2
7	AFDB:Q9UPN7	0.097	0.106	2.414E-2	881	0.102	0.118	Q9UPN7.pdb.gz	PP6R1_HUMAN Serine/threonine-protein phosphatase 6 regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PPP6R1 PE=1 SV=5
8	AFDB:Q9SQR5	0.104	0.158	3.138E-2	554	0.067	0.123	Q9SQR5.pdb.gz	SINE2_ARATH Protein SINE2 OS=Arabidopsis thaliana OX=3702 GN=SINE2 PE=1 SV=1
9	AFDB:E1C2U2	0.097	0.059	3.382E-2	2326	0.087	0.038	E1C2U2.pdb.gz	RIF1_CHICK Telomere-associated protein RIF1 OS=Gallus gallus OX=9031 GN=RIF1 PE=3 SV=3
10	PDB:7kzpG	0.088	0.123	4.513E-2	577	0.050	0.088	7kzpG.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
11	AFDB:Q9VUL6	0.097	0.087	4.919E-2	1188	0.155	0.132	Q9VUL6.pdb.gz	Q9VUL6_DROME GH22749p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG12316 PE=2 SV=1
12	PDB:6xt9D	0.087	0.169	6.563E-2	396	0.057	0.146	6xt9D.pdb.gz
13	PDB:7dkhI	0.115	0.124	7.915E-2	914	0.061	0.068	7dkhI.pdb.gz
14	PDB:7dhgC	0.084	0.135	1.029E-1	470	0.061	0.132	7dhgC.pdb.gz
15	PDB:4bujB	0.110	0.086	1.068E-1	1367	0.050	0.037	4bujB.pdb.gz
16	PDB:7p3xA	0.101	0.156	1.195E-1	576	0.060	0.106	7p3xA.pdb.gz
17	PDB:3msvA	0.101	0.210	1.553E-1	352	0.042	0.122	3msvA.pdb.gz
18	PDB:6n7pD	0.066	0.105	1.553E-1	544	0.067	0.125	6n7pD.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
19	PDB:5dseA	0.090	0.158	1.873E-1	537	0.058	0.110	5dseA.pdb.gz
20	PDB:7r5j00	0.102	0.122	2.096E-1	756	0.040	0.054	7r5j00.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1R7R1	0.0	699	1099	0.329	0.304	SMG5_DANRE Nonsense-mediated mRNA decay factor SMG5 OS=Danio rerio OX=7955 GN=smg5 PE=2 SV=1
2	Q9UPR3	0.0	2096	1016	1.000	1.000	SMG5_HUMAN Nonsense-mediated mRNA decay factor SMG5 OS=Homo sapiens OX=9606 GN=SMG5 PE=1 SV=3
3	Q9V414	7.72e-23	107	1177	0.110	0.095	Q9V414_DROME LD36341p OS=Drosophila melanogaster OX=7227 GN=Smg5 PE=1 SV=1
4	Q95TL1	6.80e-17	87.0	463	0.054	0.119	Q95TL1_DROME LD42783p OS=Drosophila melanogaster OX=7227 GN=Smg5 PE=2 SV=1
5	Q8T080	1.22e-16	87.8	923	0.054	0.060	Q8T080_DROME LD22235p OS=Drosophila melanogaster OX=7227 GN=Smg5 PE=2 SV=1
6	E9PD50	1.89e-15	84.0	1170	0.075	0.065	E9PD50_HUMAN Nonsense-mediated mRNA decay factor OS=Homo sapiens OX=9606 GN=SMG7 PE=1 SV=1
7	Q92540	2.14e-15	84.0	1137	0.075	0.067	SMG7_HUMAN Nonsense-mediated mRNA decay factor SMG7 OS=Homo sapiens OX=9606 GN=SMG7 PE=1 SV=2
8	Q1LVF3	2.58e-15	83.6	1180	0.058	0.050	SMG7_DANRE Nonsense-mediated mRNA decay factor SMG7 OS=Danio rerio OX=7955 GN=smg7 PE=2 SV=2
9	B3DI22	2.82e-15	83.6	1130	0.058	0.052	B3DI22_DANRE Nonsense-mediated mRNA decay factor OS=Danio rerio OX=7955 GN=wu:fa99h10 PE=1 SV=1
10	A9QM73	4.09e-15	82.8	1059	0.059	0.057	SMG7_ARATH Nonsense-mediated mRNA decay factor SMG7 OS=Arabidopsis thaliana OX=3702 GN=SMG7 PE=1 SV=1
11	A0A0R4IZ84	1.54e-14	81.3	1544	0.088	0.058	EST1A_DANRE Telomerase-binding protein EST1A OS=Danio rerio OX=7955 GN=smg6 PE=2 SV=1
12	B1ALB4	1.95e-14	80.5	756	0.071	0.095	B1ALB4_HUMAN SMG7 nonsense mediated mRNA decay factor (Fragment) OS=Homo sapiens OX=9606 GN=SMG7 PE=1 SV=8
13	Q86US8	3.77e-14	79.7	1419	0.080	0.057	EST1A_HUMAN Telomerase-binding protein EST1A OS=Homo sapiens OX=9606 GN=SMG6 PE=1 SV=2
14	Q1T6W7	7.43e-10	65.9	1219	0.054	0.045	Q1T6W7_CAEEL PIN domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=smg-6 PE=1 SV=2
15	Q86BS8	1.95e-08	60.8	949	0.046	0.050	Q86BS8_DROME SMG6 protein OS=Drosophila melanogaster OX=7227 GN=Smg6 PE=2 SV=1
16	Q9VBZ6	1.98e-08	60.8	948	0.046	0.050	Q9VBZ6_DROME GH14566p OS=Drosophila melanogaster OX=7227 GN=Smg6 PE=2 SV=2
17	Q9BL68	7.59e-08	59.3	1241	0.047	0.039	Q9BL68_CAEEL PIN domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=smg-6 PE=1 SV=3
18	Q8MZI0	4.07e-07	56.6	688	0.029	0.042	Q8MZI0_DROME GM14040p OS=Drosophila melanogaster OX=7227 GN=Smg6 PE=2 SV=1
19	G5EF47	6.66e-06	52.4	458	0.035	0.079	G5EF47_CAEEL DNA/RNA-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=smg-7 PE=1 SV=1
20	O14338	0.008	42.7	891	0.020	0.022	YB33_SCHPO Uncharacterized serine-rich protein C2F12.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2F12.03c PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10374 EST1	4.1e-18	77.6	Telomerase activating protein Est1
2	PF10373 EST1_DNA_bind	2.8e-36	137.0	Est1 DNA/RNA binding domain
3	PF13638 PIN_4	0.05	25.3	PIN domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355261

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000470142	0.999	Regulator of nonsense transcripts 1
2	9606.ENSP00000309572	0.991	Telomerase reverse transcriptase
3	9606.ENSP00000362674	0.982	Histone deacetylase 8
4	9606.ENSP00000402515	0.970	Serine/threonine-protein kinase SMG1
5	9606.ENSP00000334840	0.969	Proline-rich nuclear receptor coactivator 2
6	9606.ENSP00000425133	0.969	Protein SMG7
7	9606.ENSP00000263073	0.965	Telomerase-binding protein EST1A
8	9606.ENSP00000348708	0.953	Regulator of nonsense transcripts 2
9	9606.ENSP00000364448	0.939	Regulator of nonsense transcripts 3A
10	9606.ENSP00000276201	0.932	Regulator of nonsense transcripts 3B
11	9606.ENSP00000358563	0.925	H/ACA ribonucleoprotein complex subunit 4
12	9606.ENSP00000313007	0.917	Polyadenylate-binding protein 1
13	9606.ENSP00000335153	0.913	Heat shock protein HSP 90-alpha
14	9606.ENSP00000438748	0.911	Protein SMG8
15	9606.ENSP00000309591	0.902	cAMP-dependent protein kinase catalytic subunit alpha
16	9606.ENSP00000482075	0.900	Prostaglandin E synthase 3
17	9606.ENSP00000270066	0.893	Protein SMG9
18	9606.ENSP00000364289	0.884	Nuclear cap-binding protein subunit 1
19	9606.ENSP00000416255	0.879	Eukaryotic translation initiation factor 4 gamma 1
20	9606.ENSP00000264951	0.869	5'-3' exoribonuclease 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042826	0.999	histone deacetylase binding
GO:0031625	0.999	ubiquitin protein ligase binding
GO:0070034	0.999	telomerase RNA binding
GO:0051721	0.999	protein phosphatase 2A binding
GO:0042162	0.999	telomeric DNA binding
GO:0003824	0.843	catalytic activity
GO:0140640	0.788	catalytic activity, acting on a nucleic acid
GO:0016787	0.743	hydrolase activity
GO:0140098	0.595	catalytic activity, acting on RNA
GO:0004518	0.418	nuclease activity
GO:0004540	0.352	ribonuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0000184	0.988	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0050794	0.984	regulation of cellular process
GO:0010467	0.983	gene expression
GO:0051179	0.968	localization
GO:2000278	0.960	regulation of DNA biosynthetic process
GO:0006405	0.955	RNA export from nucleus
GO:0006406	0.953	mRNA export from nucleus
GO:0032210	0.947	regulation of telomere maintenance via telomerase
GO:0019220	0.503	regulation of phosphate metabolic process
GO:0035303	0.403	regulation of dephosphorylation
GO:0048518	0.334	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	1.000	nucleus
GO:0031981	0.965	nuclear lumen
GO:0005654	0.943	nucleoplasm
GO:0032991	0.557	protein-containing complex
GO:0043232	0.555	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.743	Hydrolases.
EC:3.1.-.-	0.418	Acting on ester bonds.

[back to server]