StarFunc result for job id Q9UPS8

User Input

>input (1710 residues)
MKKIFSKKGESPLGSFARRQRSSAGGGGEPGEGAYSQPGYHVRDRDLGKIHKAASAGNVA
KVQQILLLRKNGLNDRDKMNRTALHLACANGHPEVVTLLVDRKCQLNVCDNENRTALMKA
VQCQEEKCATILLEHGADPNLADVHGNTALHYAVYNEDISVATKLLLYDANIEAKNKDDL
TPLLLAVSGKKQQMVEFLIKKKANVNAVDKLESSHQLISEYKEERIPKHSSQNSNSVDES
SEDSLSRLSGKPGVDDSWPTSDDEDLNFDTKNVPKPSLAKLMTASQQSRKNLEATYGTVR
TGNRTLFEDRDSDSQDEVVVESLPTTSIKVQCFSHPTYQSPDLLPKPSHKSLANPGLMKE
EPTKPGIAKKENGIDIIESAPLEQTNNDNLTYVDEVHKNNRSDMMSALGLGQEEDIESPW
DSESISENFPQKYVDPLAGAADGKEKNIGNEQAEDVFYIPSCMSGSRNFKMAKLEDTRNV
GMPVAHMESPERYLHLKPTIEMKDSVPNKAGGMKDVQTSKAAEHDLEVASEEEQEREGSE
NNQPQVEEERKKHRNNEMEVSANIHDGATDDAEDDDDDDGLIQKRKSGETDHQQFPRKEN
KEYASSGPALQMKEVKSTEKEKRTSKESVNSPVFGKASLLTGGLLQVDDDSSLSEIDEDE
GRPTKKTSNEKNKVKNQIQSMDDVDDLTQSSETASEDCELPHSSYKNFMLLIEQLGMECK
DSVSLLKIQDAALSCERLLELKKNHCELLTVKIKKMEDKVNVLQRELSETKEIKSQLEHQ
KVEWERELCSLRFSLNQEEEKRRNADTLYEKIREQLRRKEEQYRKEVEVKQQLELSLQTL
EMELRTVKSNLNQVVQERNDAQRQLSREQNARMLQDGILTNHLSKQKEIEMAQKKMNSEN
SHSHEEEKDLSHKNSMLQEEIAMLRLEIDTIKNQNQEKEKKCFEDLKIVKEKNEDLQKTI
KQNEETLTQTISQYNGRLSVLTAENAMLNSKLENEKQSKERLEAEVESYHSRLAAAIHDR
DQSETSKRELELAFQRARDECSRLQDKMNFDVSNLKDNNEILSQQLFKTESKLNSLEIEF
HHTRDALREKTLGLERVQKDLSQTQCQMKEMEQKYQNEQVKVNKYIGKQESVEERLSQLQ
SENMLLRQQLDDAHNKADNKEKTVINIQDQFHAIVQKLQAESEKQSLLLEERNKELISEC
NHLKERQYQYENEKAEREVVVRQLQQELADTLKKQSMSEASLEVTSRYRINLEDETQDLK
KKLGQIRNQLQEAQDRHTEAVRCAEKMQDHKQKLEKDNAKLKVTVKKQMDKIEELQKNLL
NANLSEDEKEQLKKLMELKQSLECNLDQEMKKNVELEREITGFKNLLKMTRKKLNEYENG
EFSFHGDLKTSQFEMDIQINKLKHKIDDLTAELETAGSKCLHLDTKNQILQEELLSMKTV
QKKCEKLQKNKKKLEQEVINLRSHIERNMVELGQVKQYKQEIEERARQEIAEKLKEVNLF
LQAQAASQENLEQFRENNFASMKSQMELRIKDLESELSKIKTSQEDFNKTELEKYKQLYL
EELKVRKSLSSKLTKTNERLAEVNTKLLVEKQQSRSLFTTLTTRPVMEPPCVGNLNNSLD
LNRKLIPRENLVISTSNPRASNNSMENYLSKMQQELEKNITRELKEAAAELESGSIASPL
GSTDESNLNQDLVWKASREYVQVLKKNYMI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q811D2	0.117	0.126	0.000	1581	0.580	0.627	Q811D2.pdb.gz	ANR26_MOUSE Ankyrin repeat domain-containing protein 26 OS=Mus musculus OX=10090 GN=Ankrd26 PE=1 SV=2
2	AFDB:Q9UPS8	1.000	1.000	0.000	1710	1.000	1.000	Q9UPS8.pdb.gz	ANR26_HUMAN Ankyrin repeat domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ANKRD26 PE=1 SV=4
3	AFDB:Q8N2N9	0.120	0.135	3.750E-51	1353	0.280	0.353	Q8N2N9.pdb.gz	AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens OX=9606 GN=ANKRD36B PE=1 SV=4
4	AFDB:A0A0B4K7K9	0.082	0.067	6.229E-14	2238	0.163	0.124	A0A0B4K7K9.pdb.gz	A0A0B4K7K9_DROME Bruchpilot, isoform J OS=Drosophila melanogaster OX=7227 GN=brp PE=1 SV=1
5	AFDB:Q9W737	0.093	0.127	2.303E-12	1194	0.074	0.106	Q9W737.pdb.gz	Q9W737_CHICK NOTCH-1 (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
6	AFDB:F1QZF2	0.094	0.067	4.014E-12	2468	0.069	0.048	F1QZF2.pdb.gz
7	PDB:2dvwA	0.095	0.685	1.521E-11	229	0.029	0.218	2dvwA.pdb.gz
8	AFDB:Q9VUX6	0.068	0.113	6.103E-11	860	0.066	0.131	Q9VUX6.pdb.gz	Q9VUX6_DROME Myosin binding subunit, isoform K OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=3
9	PDB:8cs9A	0.094	0.201	1.005E-10	796	0.030	0.064	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
10	PDB:6jd6B	0.089	0.728	4.504E-10	192	0.027	0.245	6jd6B.pdb.gz
11	PDB:4oauC	0.089	0.199	1.529E-9	692	0.033	0.082	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
12	AFDB:Q6UB99	0.075	0.049	2.818E-9	2663	0.077	0.049	Q6UB99.pdb.gz	ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ANKRD11 PE=1 SV=3
13	PDB:6v9hC	0.091	0.544	3.326E-9	270	0.026	0.167	6v9hC.pdb.gz
14	AFDB:E9Q4F7	0.074	0.048	4.911E-9	2643	0.076	0.049	E9Q4F7.pdb.gz	ANR11_MOUSE Ankyrin repeat domain-containing protein 11 OS=Mus musculus OX=10090 GN=Ankrd11 PE=1 SV=1
15	PDB:6pqpA	0.089	0.242	7.239E-9	615	0.029	0.081	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
16	PDB:6mwqA	0.087	0.296	9.040E-9	493	0.026	0.091	6mwqA.pdb.gz
17	PDB:1bd8A	0.086	0.873	1.129E-8	156	0.022	0.244	1bd8A.pdb.gz
18	PDB:1wg0A	0.088	0.557	1.967E-8	243	0.028	0.198	1wg0A.pdb.gz
19	PDB:5vkqA	0.091	0.104	6.316E-8	1499	0.029	0.033	5vkqA.pdb.gz
20	AFDB:Q86UP2	0.076	0.092	1.376E-7	1357	0.140	0.177	Q86UP2.pdb.gz	KTN1_HUMAN Kinectin OS=Homo sapiens OX=9606 GN=KTN1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q811D2	0.0	1543	1581	0.497	0.538	ANR26_MOUSE Ankyrin repeat domain-containing protein 26 OS=Mus musculus OX=10090 GN=Ankrd26 PE=1 SV=2
2	Q9UPS8	0.0	3488	1710	1.000	1.000	ANR26_HUMAN Ankyrin repeat domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ANKRD26 PE=1 SV=4
3	Q8N2N9	2.37e-157	519	1353	0.182	0.230	AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens OX=9606 GN=ANKRD36B PE=1 SV=4
4	Q6NSI1	6.21e-89	295	321	0.091	0.483	AR26L_HUMAN Putative ankyrin repeat domain-containing protein 26-like protein OS=Homo sapiens OX=9606 GN=ANKRD26P1 PE=5 SV=2
5	Q5TYW2	1.06e-84	299	823	0.112	0.233	A20A1_HUMAN Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens OX=9606 GN=ANKRD20A1 PE=2 SV=1
6	A0JP26	1.47e-66	239	581	0.070	0.207	POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens OX=9606 GN=POTEB3 PE=1 SV=2
7	Q9D504	7.63e-64	221	279	0.068	0.416	ANKR7_MOUSE Ankyrin repeat domain-containing protein 7 OS=Mus musculus OX=10090 GN=Ankrd7 PE=2 SV=2
8	Q6S8J3	9.99e-64	240	1075	0.081	0.128	POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens OX=9606 GN=POTEE PE=2 SV=3
9	P0CG39	1.07e-63	239	1038	0.078	0.129	POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens OX=9606 GN=POTEJ PE=3 SV=1
10	A5A3E0	1.33e-63	239	1075	0.078	0.125	POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens OX=9606 GN=POTEF PE=1 SV=2
11	P0CG38	2.36e-63	239	1075	0.078	0.125	POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens OX=9606 GN=POTEI PE=3 SV=1
12	A1A5B0	6.49e-57	202	309	0.057	0.317	A1A5B0_HUMAN ANKRD36 protein OS=Homo sapiens OX=9606 GN=ANKRD36 PE=1 SV=1
13	A0A140VJE5	4.35e-55	195	254	0.054	0.362	A0A140VJE5_HUMAN Testicular tissue protein Li 19 OS=Homo sapiens OX=9606 PE=2 SV=1
14	Q92527	4.35e-55	195	254	0.054	0.362	ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens OX=9606 GN=ANKRD7 PE=2 SV=3
15	C9JIJ7	1.14e-54	194	263	0.054	0.350	C9JIJ7_HUMAN Ankyrin repeat domain 7 OS=Homo sapiens OX=9606 GN=ANKRD7 PE=1 SV=2
16	Q96IX9	1.82e-29	116	119	0.037	0.538	A26L1_HUMAN Putative ankyrin repeat domain-containing protein 26-like 1 OS=Homo sapiens OX=9606 GN=ANKRD36BP1 PE=5 SV=1
17	Q54KA7	5.61e-17	89.7	986	0.035	0.060	SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum OX=44689 GN=secG PE=2 SV=1
18	Q9P0K7	5.86e-16	86.7	980	0.032	0.056	RAI14_HUMAN Ankycorbin OS=Homo sapiens OX=9606 GN=RAI14 PE=1 SV=2
19	Q8GZ22	1.95e-15	80.1	240	0.032	0.225	Q8GZ22_ARATH Ankyrin repeat family protein OS=Arabidopsis thaliana OX=3702 GN=At2g03430 PE=1 SV=1
20	P53355	7.12e-15	83.2	1430	0.030	0.036	DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=DAPK1 PE=1 SV=6

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	4.6e-18	76.0	Ankyrin repeat
2	PF12796 Ank_2	2.3e-21	87.5	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	2.5e-10	50.5	Ankyrin repeat
4	PF13637 Ank_4	3.5e-16	70.6	Ankyrin repeats (many copies)
5	PF13857 Ank_5	4e-14	63.7	Ankyrin repeats (many copies)
6	PF14915 CCDC144C	2e-146	498.5	CCDC144C protein coiled-coil region
7	PF12001 DUF3496	1.5e-49	178.3	Domain of unknown function (DUF3496)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365255

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354720	0.689	Structural maintenance of chromosomes protein 3
2	9606.ENSP00000342181	0.681	Signal recognition particle subunit SRP72
3	9606.ENSP00000379658	0.673	Transcription factor ETV6
4	9606.ENSP00000407552	0.668	Growth arrest-specific protein 7
5	9606.ENSP00000422753	0.653	Probable ATP-dependent RNA helicase DDX41
6	9606.ENSP00000350036	0.649	Structural maintenance of chromosomes protein 1B
7	9606.ENSP00000286398	0.642	Structural maintenance of chromosomes protein 2
8	9606.ENSP00000323421	0.642	Structural maintenance of chromosomes protein 1A
9	9606.ENSP00000349961	0.642	Structural maintenance of chromosomes protein 4
10	9606.ENSP00000246868	0.619	Ribosome maturation protein SBDS
11	9606.ENSP00000216181	0.618	Myosin-9
12	9606.ENSP00000297661	0.610	Ubiquitin-associated protein 1
13	9606.ENSP00000261893	0.580	Serine beta-lactamase-like protein LACTB, mitochondrial
14	9606.ENSP00000345681	0.572	Endothelial transcription factor GATA-2
15	9606.ENSP00000373477	0.552	Glutathione peroxidase 3
16	9606.ENSP00000305426	0.549	Tubby protein homolog
17	9606.ENSP00000417659	0.538	Protein phosphatase 1L
18	9606.ENSP00000380880	0.530	PQ-loop repeat-containing protein 1
19	9606.ENSP00000324292	0.523	Fas-binding factor 1
20	9606.ENSP00000334879	0.522	Ankyrin repeat domain-containing protein SOWAHB

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050789	0.981	regulation of biological process
GO:0050794	0.941	regulation of cellular process
GO:0050896	0.599	response to stimulus
GO:0048519	0.518	negative regulation of biological process
GO:0048523	0.511	negative regulation of cellular process
GO:0071840	0.434	cellular component organization or biogenesis
GO:0016043	0.349	cellular component organization
GO:0051716	0.341	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005856	0.998	cytoskeleton
GO:0015630	0.986	microtubule cytoskeleton
GO:0005815	0.953	microtubule organizing center
GO:0005829	0.938	cytosol
GO:0005813	0.875	centrosome
GO:0043231	0.832	intracellular membrane-bounded organelle
GO:0005634	0.678	nucleus
GO:0043233	0.538	organelle lumen
GO:0070013	0.458	intracellular organelle lumen
GO:0031981	0.446	nuclear lumen
GO:0032991	0.398	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]