StarFunc result for job id Q9UPT6

User Input

>input (1336 residues)
MMEIQMDEGGGVVVYQDDYCSGSVMSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVV
NVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRRQAEEKFIEFEDALEQEKK
ELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIE
RSKMQQVGGNSQTESSLPGRRKERPTSLNVFPLADGTVRAQIGGKLVPAGDHWHLSDLGQ
LQSSSSYQCPQDEMSESGQSSAAATPSTTGTKSNTPTSSVPSAAVTPLNESLQPLGDYGV
GSKNSKRAREKRDSRNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTPELDMCPETRLD
RTGSSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSVRDDFFGMGKEV
GNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLRGELEAAKQAKVKLENRIKELE
EELKRVKSEAIIARREPKEEAEDVSSYLCTESDKIPMAQRRRFTRVEMARVLMERNQYKE
RLMELQEAVRWTEMIRASREHPSVQEKKKSTIWQFFSRLFSSSSSPPPAKRPYPSVNIHY
KSPTTAGFSQRRNHAMCPISAGSRPLEFFPDDDCTSSARREQKREQYRQVREHVRNDDGR
LQACGWSLPAKYKQLSPNGGQEDTRMKNVPVPVYCRPLVEKDPTMKLWCAAGVNLSGWRP
NEDDAGNGVKPAPGRDPLTCDREGDGEPKSAHTSPEKKKAKELPEMDATSSRVWILTSTL
TTSKVVIIDANQPGTVVDQFTVCNAHVLCISSIPAASDSDYPPGEMFLDSDVNPEDPGAD
GVLAGITLVGCATRCNVPRSNCSSRGDTPVLDKGQGEVATIANGKVNPSQSTEEATEATE
VPDPGPSEPETATLRPGPLTEHVFTDPAPTPSSGPQPGSENGPEPDSSSTRPEPEPSGDP
TGAGSSAAPTMWLGAQNGWLYVHSAVANWKKCLHSIKLKDSVLSLVHVKGRVLVALADGT
LAIFHRGEDGQWDLSNYHLMDLGHPHHSIRCMAVVYDRVWCGYKNKVHVIQPKTMQIEKS
FDAHPRRESQVRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTGKL
GFSFVRITALLVAGSRLWVGTGNGVVISIPLTETVVLHRGQLLGLRANKTSPTSGEGARP
GGIIHVYGDDSSDRAASSFIPYCSMAQAQLCFHGHRDAVKFFVSVPGNVLATLNGSVLDS
PAEGPGPAAPASEVEGQKLRNVLVLSGGEGYIDFRIGDGEDDETEEGAGDMSQVKPVLSK
AERSHIIVWQVSYTPE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K6E8	0.387	0.383	0.000	1352	0.578	0.571	A0A0G2K6E8.pdb.gz	A0A0G2K6E8_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
2	AFDB:E9QGL9	0.482	0.490	0.000	1313	0.705	0.717	E9QGL9.pdb.gz
3	AFDB:Q9ESN9	0.497	0.497	0.000	1337	0.938	0.937	Q9ESN9.pdb.gz	JIP3_MOUSE C-Jun-amino-terminal kinase-interacting protein 3 OS=Mus musculus OX=10090 GN=Mapk8ip3 PE=1 SV=1
4	AFDB:Q9GQF1	0.358	0.387	4.257E-86	1227	0.401	0.437	Q9GQF1.pdb.gz	JIP3_DROME JNK-interacting protein 3 OS=Drosophila melanogaster OX=7227 GN=syd PE=1 SV=1
5	AFDB:O15013	0.254	0.248	2.861E-28	1369	0.159	0.155	O15013.pdb.gz	ARHGA_HUMAN Rho guanine nucleotide exchange factor 10 OS=Homo sapiens OX=9606 GN=ARHGEF10 PE=1 SV=4
6	AFDB:Q96PE2	0.256	0.169	1.894E-25	2063	0.172	0.111	Q96PE2.pdb.gz	ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens OX=9606 GN=ARHGEF17 PE=1 SV=1
7	AFDB:Q9H2Y7	0.124	0.090	5.609E-14	1883	0.116	0.082	Q9H2Y7.pdb.gz	ZN106_HUMAN Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106 PE=1 SV=1
8	AFDB:F1N9Y3	0.151	0.248	8.362E-11	773	0.097	0.167	F1N9Y3.pdb.gz
9	AFDB:Q04724	0.145	0.240	1.289E-10	770	0.092	0.160	Q04724.pdb.gz	TLE1_HUMAN Transducin-like enhancer protein 1 OS=Homo sapiens OX=9606 GN=TLE1 PE=1 SV=2
10	AFDB:H0YL70	0.150	0.246	1.690E-10	782	0.094	0.161	H0YL70.pdb.gz	H0YL70_HUMAN TLE family member 3, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=1
11	PDB:6xr4A	0.124	0.157	1.297E-9	1040	0.034	0.044	6xr4A.pdb.gz
12	PDB:7mq8LN	0.143	0.270	1.297E-9	671	0.029	0.058	7mq8LN.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7ajuCH	0.162	0.428	2.228E-9	467	0.034	0.099	7ajuCH.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
14	PDB:5jpqY	0.153	0.507	3.435E-9	365	0.034	0.126	5jpqY.pdb.gz	Architecture of the 90S Pre-ribosome: A Structural View on the Birth of the Eukaryotic Ribosome.
15	PDB:7apkF	0.129	0.469	6.230E-9	337	0.025	0.101	7apkF.pdb.gz
16	PDB:6ttuT	0.125	0.404	1.259E-8	394	0.022	0.076	6ttuT.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
17	PDB:5o9zL	0.133	0.363	1.403E-8	459	0.028	0.083	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
18	PDB:7mq8SG	0.130	0.371	1.651E-8	389	0.029	0.100	7mq8SG.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:7ewpD	0.131	0.468	1.839E-8	339	0.030	0.118	7ewpD.pdb.gz
20	PDB:7jvrB	0.123	0.451	3.160E-8	342	0.022	0.085	7jvrB.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K6E8	0.0	1404	1352	0.588	0.581	A0A0G2K6E8_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
2	A0A8I5Y1R0	0.0	1394	1305	0.576	0.589	A0A8I5Y1R0_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
3	A0A8I5ZJK4	0.0	1397	1334	0.585	0.586	A0A8I5ZJK4_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
4	A0A8I6A5S1	0.0	1077	1178	0.470	0.533	A0A8I6A5S1_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
5	A0A8I6AXC7	0.0	1358	1305	0.575	0.589	A0A8I6AXC7_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
6	A0A8I6B3N0	0.0	1364	1321	0.578	0.584	A0A8I6B3N0_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
7	A0A8I6B484	0.0	1087	1169	0.472	0.539	A0A8I6B484_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
8	E9PSJ4	0.0	1408	1324	0.587	0.592	E9PSJ4_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=3
9	E9PSK7	0.0	2529	1322	0.932	0.942	JIP3_RAT C-Jun-amino-terminal kinase-interacting protein 3 OS=Rattus norvegicus OX=10116 GN=Mapk8ip3 PE=1 SV=2
10	L7RKJ8	0.0	1801	1299	0.712	0.732	L7RKJ8_DANRE C-Jun-amino-terminal kinase-interacting protein 3 OS=Danio rerio OX=7955 GN=mapk8ip3 PE=2 SV=1
11	O60271	0.0	1373	1321	0.579	0.586	JIP4_HUMAN C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9 PE=1 SV=4
12	P34609	0.0	596	1190	0.270	0.303	JIP_CAEEL JNK-interacting protein OS=Caenorhabditis elegans OX=6239 GN=unc-16 PE=1 SV=4
13	Q58A65	0.0	1393	1321	0.578	0.584	JIP4_MOUSE C-Jun-amino-terminal kinase-interacting protein 4 OS=Mus musculus OX=10090 GN=Spag9 PE=1 SV=2
14	Q9ESN9	0.0	2563	1337	0.938	0.937	JIP3_MOUSE C-Jun-amino-terminal kinase-interacting protein 3 OS=Mus musculus OX=10090 GN=Mapk8ip3 PE=1 SV=1
15	Q9GQF1	0.0	663	1227	0.316	0.344	JIP3_DROME JNK-interacting protein 3 OS=Drosophila melanogaster OX=7227 GN=syd PE=1 SV=1
16	Q9UPT6	0.0	2769	1336	1.000	1.000	JIP3_HUMAN C-Jun-amino-terminal kinase-interacting protein 3 OS=Homo sapiens OX=9606 GN=MAPK8IP3 PE=1 SV=3
17	H0YBS5	7.40e-48	173	250	0.084	0.448	H0YBS5_HUMAN Sperm associated antigen 9 (Fragment) OS=Homo sapiens OX=9606 GN=SPAG9 PE=1 SV=1
18	Q96PE2	1.60e-30	134	2063	0.080	0.052	ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens OX=9606 GN=ARHGEF17 PE=1 SV=1
19	Q9HCE6	2.23e-24	113	1279	0.060	0.063	ARGAL_HUMAN Rho guanine nucleotide exchange factor 10-like protein OS=Homo sapiens OX=9606 GN=ARHGEF10L PE=1 SV=4
20	M9PHU0	3.95e-22	106	2263	0.047	0.028	M9PHU0_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG12432 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10186 ATG14	0.63	20.7	Vacuolar sorting 38 and autophagy-related subunit 14
2	PF16471 JIP_LZII	1.6e-27	106.8	JNK-interacting protein leucine zipper II
3	PF09744 Jnk-SapK_ap_N	5.7e-49	177.8	JNK_SAPK-associated protein-1
4	PF15035 Rootletin	11	17.5	Ciliary rootlet component, centrosome cohesion
5	PF19056 WD40_2	8.2e-49	178.2	WD40 repeated domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000250894

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000298316	0.997	ADP-ribosylation factor 6
2	9606.ENSP00000378974	0.994	Mitogen-activated protein kinase 8
3	9606.ENSP00000352157	0.990	Mitogen-activated protein kinase 10
4	9606.ENSP00000410402	0.989	Dual specificity mitogen-activated protein kinase kinase 4
5	9606.ENSP00000414982	0.979	Kinesin light chain 1
6	9606.ENSP00000241014	0.978	C-Jun-amino-terminal kinase-interacting protein 1
7	9606.ENSP00000394560	0.970	Mitogen-activated protein kinase 9
8	9606.ENSP00000439065	0.958	Uncharacterized protein
9	9606.ENSP00000341189	0.957	Focal adhesion kinase 1
10	9606.ENSP00000381070	0.950	Dual specificity mitogen-activated protein kinase kinase 7
11	9606.ENSP00000351908	0.946	Mitogen-activated protein kinase kinase kinase 5
12	9606.ENSP00000330572	0.941	C-Jun-amino-terminal kinase-interacting protein 2
13	9606.ENSP00000362680	0.938	Proto-oncogene tyrosine-protein kinase Src
14	9606.ENSP00000382423	0.931	Mitogen-activated protein kinase kinase kinase 1
15	9606.ENSP00000354791	0.919	Dynactin subunit 1
16	9606.ENSP00000346671	0.904	Tyrosine-protein kinase Fyn
17	9606.ENSP00000462468	0.903	Tyrosine-protein kinase Yes
18	9606.ENSP00000309597	0.902	Mitogen-activated protein kinase kinase kinase 11
19	9606.ENSP00000337825	0.901	Tyrosine-protein kinase Lck
20	9606.ENSP00000438388	0.817	Kinesin-like protein KIF1A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030674	0.999	protein-macromolecule adaptor activity
GO:0019899	0.999	enzyme binding
GO:0019901	0.985	protein kinase binding
GO:0008092	0.911	cytoskeletal protein binding
GO:0031434	0.899	mitogen-activated protein kinase kinase binding
GO:0019894	0.896	kinesin binding
GO:0005078	0.344	MAP-kinase scaffold activity
GO:0031435	0.304	mitogen-activated protein kinase kinase kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.980	cellular process
GO:0048519	0.940	negative regulation of biological process
GO:0009966	0.926	regulation of signal transduction
GO:0048523	0.910	negative regulation of cellular process
GO:0019222	0.909	regulation of metabolic process
GO:1902531	0.907	regulation of intracellular signal transduction
GO:0030705	0.898	cytoskeleton-dependent intracellular transport
GO:0050896	0.889	response to stimulus
GO:0099111	0.882	microtubule-based transport
GO:0010941	0.834	regulation of cell death
GO:0048518	0.820	positive regulation of biological process
GO:0032502	0.814	developmental process
GO:0001932	0.792	regulation of protein phosphorylation
GO:0048522	0.784	positive regulation of cellular process
GO:0051093	0.777	negative regulation of developmental process
GO:0007017	0.774	microtubule-based process
GO:0032501	0.746	multicellular organismal process
GO:0051716	0.742	cellular response to stimulus
GO:0051128	0.723	regulation of cellular component organization
GO:0045664	0.720	regulation of neuron differentiation
GO:0065008	0.704	regulation of biological quality
GO:0051172	0.676	negative regulation of nitrogen compound metabolic process
GO:0010605	0.675	negative regulation of macromolecule metabolic process
GO:0048856	0.666	anatomical structure development
GO:0010970	0.652	transport along microtubule
GO:0031647	0.588	regulation of protein stability
GO:0051248	0.586	negative regulation of protein metabolic process
GO:0043408	0.565	regulation of MAPK cascade
GO:0001558	0.525	regulation of cell growth
GO:0071840	0.507	cellular component organization or biogenesis
GO:0048638	0.507	regulation of developmental growth
GO:0080134	0.475	regulation of response to stress
GO:0016043	0.470	cellular component organization
GO:0007275	0.464	multicellular organism development
GO:0007154	0.441	cell communication
GO:0023052	0.430	signaling
GO:0023056	0.415	positive regulation of signaling
GO:0010647	0.413	positive regulation of cell communication
GO:0007165	0.398	signal transduction
GO:0009893	0.394	positive regulation of metabolic process
GO:0048731	0.347	system development
GO:0008088	0.337	axo-dendritic transport
GO:0010604	0.334	positive regulation of macromolecule metabolic process
GO:0006950	0.327	response to stress
GO:0050821	0.318	protein stabilization
GO:0080135	0.318	regulation of cellular response to stress
GO:0048584	0.304	positive regulation of response to stimulus
GO:0008152	0.301	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0012505	0.997	endomembrane system
GO:0005829	0.993	cytosol
GO:0043227	0.989	membrane-bounded organelle
GO:0043229	0.986	intracellular organelle
GO:0043231	0.982	intracellular membrane-bounded organelle
GO:0016020	0.978	membrane
GO:0005886	0.949	plasma membrane
GO:0120025	0.805	plasma membrane bounded cell projection
GO:0031090	0.768	organelle membrane
GO:0031982	0.749	vesicle
GO:0043228	0.694	non-membrane-bounded organelle
GO:0098588	0.671	bounding membrane of organelle
GO:0043232	0.671	intracellular non-membrane-bounded organelle
GO:0043005	0.661	neuron projection
GO:0036477	0.657	somatodendritic compartment
GO:0030425	0.523	dendrite
GO:0043233	0.495	organelle lumen
GO:0031981	0.489	nuclear lumen
GO:0030424	0.483	axon
GO:0005654	0.395	nucleoplasm
GO:0032991	0.385	protein-containing complex
GO:0005856	0.365	cytoskeleton
GO:0005576	0.348	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]