StarFunc result for job id Q9UPT8

User Input

>input (1303 residues)
MEAAPGTPPPPPSESPPPPSPPPPSTPSPPPCSPDARPATPHLLHHRLPLPDDREDGELE
EGELEDDGAEETQDTSGGPERSRKEKGEKHHSDSDEEKSHRRLKRKRKKEREKEKRRSKK
RRKSKHKRHASSSDDFSDFSDDSDFSPSEKGHRKYREYSPPYAPSHQQYPPSHATPLPKK
AYSKMDSKSYGMYEDYENEQYGEYEGDEEEDMGKEDYDDFTKELNQYRRAKEGSSRGRGS
RGRGRGYRGRGSRGGSRGRGMGRGSRGRGRGSMGGDHPEDEEDFYEEEMDYGESEEPMGD
DDYDEYSKELNQYRRSKDSRGRGLSRGRGRGSRGRGKGMGRGRGRGGSRGGMNKGGMNDD
EDFYDEDMGDGGGGSYRSRDHDKPHQQSDKKGKVICKYFVEGRCTWGDHCNFSHDIELPK
KRELCKFYITGFCARAENCPYMHGDFPCKLYHTTGNCINGDDCMFSHDPLTEETRELLDK
MLADDAEAGAEDEKEVEELKKQGINPLPKPPPGVGLLPTPPRPPGPQAPTSPNGRPMQGG
PPPPPPPPPPPPGPPQMPMPVHEPLSPQQLQQQDMYNKKIPSLFEIVVRPTGQLAEKLGV
RFPGPGGPPGPMGPGPNMGPPGPMGGPMHPDMHPDMHPDMHPDMHADMHADMPMGPGMNP
GPPMGPGGPPMMPYGPGDSPHSGMMPPIPPAQNFYENFYQQQEGMEMEPGLLGDAEDYGH
YEELPGEPGEHLFPEHPLEPDSFSEGGPPGRPKPGAGVPDFLPSAQRALYLRIQQKQQEE
EERARRLAESSKQDRENEEGDTGNWYSSDEDEGGSSVTSILKTLRQQTSSRPPASVGELS
SSGLGDPRLQKGHPTGSRLADPRLSRDPRLTRHVEASGGSGPGDSGPSDPRLARALPTSK
PEGSLHSSPVGPSSSKGSGPPPTEEEEGERALREKAVNIPLDPLPGHPLRDPRSQLQQFS
HIKKDVTLSKPSFARTVLWNPEDLIPLPIPKQDAVPPVPAALQSMPTLDPRLHRAATAGP
PNARQRPGASTDSSTQGANLPDFELLSRILKTVNATGSSAAPGSSDKPSDPRVRKAPTDP
RLQKPTDSTASSRAAKPGPAEAPSPTASPSGDASPPATAPYDPRVLAAGGLGQGGGGGQS
SVLSGISLYDPRTPNAGGKATEPAADTGAQPKGAEGNGKSSASKAKEPPFVRKSALEQPE
TGKAGADGGTPTDRYNSYNRPRPKAAAAPAATTATPPPEGAPPQPGVHNLPVPTLFGTVK
QTPKTGSGSPFAGNSPAREGEQDAASLKDVFKGFDPTASPFCQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZPZ3	0.241	0.241	0.000	1304	0.915	0.914	Q6ZPZ3.pdb.gz	ZC3H4_MOUSE Zinc finger CCCH domain-containing protein 4 OS=Mus musculus OX=10090 GN=Zc3h4 PE=1 SV=2
2	AFDB:Q9VUA5	0.042	0.050	8.758E-6	982	0.114	0.152	Q9VUA5.pdb.gz	Q9VUA5_DROME LD42058p OS=Drosophila melanogaster OX=7227 GN=ssp2 PE=1 SV=1
3	AFDB:Q99700	0.045	0.045	3.756E-5	1313	0.163	0.162	Q99700.pdb.gz	ATX2_HUMAN Ataxin-2 OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=2
4	AFDB:E9Q4F7	0.046	0.028	7.797E-4	2643	0.160	0.079	E9Q4F7.pdb.gz	ANR11_MOUSE Ankyrin repeat domain-containing protein 11 OS=Mus musculus OX=10090 GN=Ankrd11 PE=1 SV=1
5	AFDB:Q9C0A6	0.045	0.043	1.056E-3	1442	0.134	0.121	Q9C0A6.pdb.gz	SETD5_HUMAN Histone-lysine N-methyltransferase SETD5 OS=Homo sapiens OX=9606 GN=SETD5 PE=1 SV=2
6	AFDB:Q69ZZ9	0.037	0.046	4.011E-3	979	0.127	0.169	Q69ZZ9.pdb.gz	K0754_MOUSE Microtubule-actin cross-linking factor 1, isoforms 6/7 OS=Mus musculus OX=10090 GN=Macf1 PE=2 SV=3
7	AFDB:Q6UB99	0.028	0.025	4.811E-3	2663	0.169	0.083	Q6UB99.pdb.gz	ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ANKRD11 PE=1 SV=3
8	AFDB:Q5T8A7	0.045	0.048	5.772E-3	1209	0.145	0.156	Q5T8A7.pdb.gz	PPR26_HUMAN Protein phosphatase 1 regulatory subunit 26 OS=Homo sapiens OX=9606 GN=PPP1R26 PE=1 SV=1
9	AFDB:P13709	0.052	0.040	6.516E-3	2038	0.168	0.107	P13709.pdb.gz	FSH_DROME Homeotic protein female sterile OS=Drosophila melanogaster OX=7227 GN=fs(1)h PE=1 SV=2
10	AFDB:Q8K083	0.052	0.052	7.817E-3	1302	0.130	0.131	Q8K083.pdb.gz	ZN536_MOUSE Zinc finger protein 536 OS=Mus musculus OX=10090 GN=Znf536 PE=1 SV=1
11	PDB:7abiP	0.025	0.114	5.487E-1	237	0.012	0.063	7abiP.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
12	PDB:6id0O	0.019	0.072	1.006	290	0.009	0.041	6id0O.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
13	PDB:7dvqM	0.023	0.114	2.215	191	0.010	0.068	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
14	PDB:5gm6a	0.019	0.174	4.586	123	0.009	0.098	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
15	PDB:7r5jV0	0.036	0.115	5.177	273	0.018	0.084	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
16	PDB:7jtkG	0.028	0.056	7.012	421	0.011	0.033	7jtkG.pdb.gz
17	PDB:7dvqR	0.027	0.121	7.450	241	0.025	0.137	7dvqR.pdb.gz	Structure of the activated human minor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZPZ3	0.0	1578	1304	0.883	0.883	ZC3H4_MOUSE Zinc finger CCCH domain-containing protein 4 OS=Mus musculus OX=10090 GN=Zc3h4 PE=1 SV=2
2	Q9UPT8	0.0	2589	1303	1.000	1.000	ZC3H4_HUMAN Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3
3	Q9JJ48	2.79e-35	139	305	0.041	0.174	ZC3H8_MOUSE Zinc finger CCCH domain-containing protein 8 OS=Mus musculus OX=10090 GN=Zc3h8 PE=1 SV=2
4	Q8N5P1	5.76e-35	137	291	0.041	0.186	ZC3H8_HUMAN Zinc finger CCCH domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZC3H8 PE=1 SV=2
5	Q22805	2.38e-18	92.8	574	0.058	0.131	Q22805_CAEEL C3H1-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_T26A8.4 PE=1 SV=1
6	P22293	3.00e-15	84.0	1325	0.025	0.024	SUS_DROME Protein suppressor of sable OS=Drosophila melanogaster OX=7227 GN=su(sable) PE=1 SV=2
7	P41000	5.40e-08	59.7	583	0.015	0.034	CPS3_SCHPO Protein cps3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cps3 PE=1 SV=3
8	Q9ERV1	7.70e-06	52.4	416	0.017	0.053	MKRN2_MOUSE E3 ubiquitin-protein ligase makorin-2 OS=Mus musculus OX=10090 GN=Mkrn2 PE=1 SV=2
9	Q9H000	1.07e-05	52.0	416	0.016	0.050	MKRN2_HUMAN E3 ubiquitin-protein ligase makorin-2 OS=Homo sapiens OX=9606 GN=MKRN2 PE=1 SV=2
10	B0F0H3	1.57e-05	51.2	409	0.016	0.051	MKRN2_XENLA E3 ubiquitin-protein ligase makorin-2 OS=Xenopus laevis OX=8355 GN=mkrn2 PE=2 SV=2
11	O95639	2.70e-05	49.7	269	0.025	0.123	CPSF4_HUMAN Cleavage and polyadenylation specificity factor subunit 4 OS=Homo sapiens OX=9606 GN=CPSF4 PE=1 SV=1
12	Q9UTD1	3.36e-05	48.1	170	0.018	0.141	YTH1_SCHPO mRNA 3'-end-processing protein yth1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=yth1 PE=3 SV=1
13	O19137	9.02e-05	47.8	243	0.025	0.136	CPSF4_BOVIN Cleavage and polyadenylation specificity factor subunit 4 OS=Bos taurus OX=9913 GN=CPSF4 PE=1 SV=1
14	Q9UHC7	1.69e-04	48.1	482	0.015	0.039	MKRN1_HUMAN E3 ubiquitin-protein ligase makorin-1 OS=Homo sapiens OX=9606 GN=MKRN1 PE=1 SV=3
15	Q98881	1.78e-04	47.4	271	0.030	0.144	Q98881_DANRE Cleavage and polyadenylation specificity factor subunit 4 OS=Danio rerio OX=7955 GN=nar PE=1 SV=1
16	Q9QXP6	2.36e-04	47.8	481	0.015	0.040	MKRN1_MOUSE E3 ubiquitin-protein ligase makorin-1 OS=Mus musculus OX=10090 GN=Mkrn1 PE=1 SV=1
17	Q06102	0.001	44.3	208	0.015	0.091	YTH1_YEAST mRNA 3'-end-processing protein YTH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YTH1 PE=1 SV=1
18	Q9VPT8	0.032	40.4	296	0.014	0.061	CPSF4_DROME Cleavage and polyadenylation specificity factor subunit 4 OS=Drosophila melanogaster OX=7227 GN=Clp PE=1 SV=1
19	Q3UH66	2.3	35.0	2149	0.017	0.010	WNK2_MOUSE Serine/threonine-protein kinase WNK2 OS=Mus musculus OX=10090 GN=Wnk2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16131 Torus	1.1	21.3	Torus domain
2	PF00642 zf-CCCH	3.4e-09	47.7	Zinc finger C-x8-C-x5-C-x3-H type (and similar)
3	PF14608 zf-CCCH_2	1.2e-06	40.0	RNA-binding, Nab2-type zinc finger
4	PF18044 zf-CCCH_4	2.8e-08	44.6	CCCH-type zinc finger
5	PF18345 zf_CCCH_4	1.6e-12	58.2	Zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000253048

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296490	0.847	WD repeat-containing protein 82
2	9606.ENSP00000298875	0.822	Cleavage and polyadenylation specificity factor subunit 2
3	9606.ENSP00000291386	0.820	RNA polymerase II subunit A C-terminal domain phosphatase SSU72
4	9606.ENSP00000245934	0.812	Symplekin
5	9606.ENSP00000315791	0.800	Cleavage stimulation factor subunit 3
6	9606.ENSP00000317872	0.792	E3 ubiquitin-protein ligase RBBP6
7	9606.ENSP00000217109	0.773	Cleavage stimulation factor subunit 1
8	9606.ENSP00000336752	0.754	Pre-mRNA 3'-end-processing factor FIP1
9	9606.ENSP00000484669	0.741	Cleavage and polyadenylation specificity factor subunit 1
10	9606.ENSP00000238112	0.725	Cleavage and polyadenylation specificity factor subunit 3
11	9606.ENSP00000483408	0.705	RNA-binding protein 26
12	9606.ENSP00000300291	0.686	Cleavage and polyadenylation specificity factor subunit 5
13	9606.ENSP00000362063	0.686	Cleavage stimulation factor subunit 2
14	9606.ENSP00000266070	0.683	Death-inducer obliterator 1
15	9606.ENSP00000265271	0.677	RNA-binding protein 27
16	9606.ENSP00000320924	0.672	WAS/WASL-interacting protein family member 2
17	9606.ENSP00000434995	0.671	Polyribonucleotide 5'-hydroxyl-kinase Clp1
18	9606.ENSP00000262291	0.658	Vacuole membrane protein 1
19	9606.ENSP00000332444	0.649	Cleavage stimulation factor subunit 2 tau variant
20	9606.ENSP00000298281	0.648	Pre-mRNA cleavage complex 2 protein Pcf11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	1.000	chromatin binding
GO:0003723	1.000	RNA binding
GO:1990841	0.797	promoter-specific chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050789	0.995	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0071704	0.991	organic substance metabolic process
GO:0044238	0.988	primary metabolic process
GO:0043170	0.981	macromolecule metabolic process
GO:0006807	0.977	nitrogen compound metabolic process
GO:0044237	0.972	cellular metabolic process
GO:0019222	0.969	regulation of metabolic process
GO:0060255	0.964	regulation of macromolecule metabolic process
GO:0080090	0.864	regulation of primary metabolic process
GO:0031323	0.864	regulation of cellular metabolic process
GO:0051171	0.862	regulation of nitrogen compound metabolic process
GO:0010468	0.849	regulation of gene expression
GO:0051252	0.839	regulation of RNA metabolic process
GO:0016070	0.838	RNA metabolic process
GO:0048519	0.827	negative regulation of biological process
GO:0044260	0.804	cellular macromolecule metabolic process
GO:0034660	0.764	ncRNA metabolic process
GO:0032784	0.760	regulation of DNA-templated transcription elongation
GO:0044265	0.755	cellular macromolecule catabolic process
GO:0140747	0.747	regulation of ncRNA transcription
GO:0034661	0.747	ncRNA catabolic process
GO:0071027	0.746	nuclear RNA surveillance
GO:0048523	0.700	negative regulation of cellular process
GO:0010605	0.676	negative regulation of macromolecule metabolic process
GO:0051172	0.671	negative regulation of nitrogen compound metabolic process
GO:0031324	0.669	negative regulation of cellular metabolic process
GO:0045934	0.662	negative regulation of nucleobase-containing compound metabolic process
GO:0045892	0.641	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.999	cytosol
GO:0032991	0.306	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]