StarFunc result for job id Q9UPU3

User Input

>input (1222 residues)
MEAARTERPAGRPGAPLVRTGLLLLSTWVLAGAEITWDATGGPGRPAAPASRPPALSPLS
PRAVASQWPEELASARRAAVLGRRAGPELLPQQGGGRGGEMQVEAGGTSPAGERRGRGIP
APAKLGGARRSRRAQPPITQERGDAWATAPADGSRGSRPLAKGSREEVKAPRAGGSAAED
LRLPSTSFALTGDSAHNQAMVHWSGHNSSVILILTKLYDFNLGSVTESSLWRSTDYGTTY
EKLNDKVGLKTVLSYLYVNPTNKRKIMLLSDPEMESSILISSDEGATYQKYRLTFYIQSL
LFHPKQEDWVLAYSLDQKLYSSMDFGRRWQLMHERITPNRFYWSVAGLDKEADLVHMEVR
TTDGYAHYLTCRIQECAETTRSGPFARSIDISSLVVQDEYIFIQVTTSGRASYYVSYRRE
AFAQIKLPKYSLPKDMHIISTDENQVFAAVQEWNQNDTYNLYISDTRGIYFTLAMENIKS
SRGLMGNIIIELYEVAGIKGIFLANKKVDDQVKTYITYNKGRDWRLLQAPDVDLRGSPVH
CLLPFCSLHLHLQLSENPYSSGRISSKETAPGLVVATGNIGPELSYTDIGVFISSDGGNT
WRQIFDEEYNVWFLDWGGALVAMKHTPLPVRHLWVSFDEGHSWDKYGFTSVPLFVDGALV
EAGMETHIMTVFGHFSLRSEWQLVKVDYKSIFSRHCTKEDYQTWHLLNQGEPCVMGERKI
FKKRKPGAQCALGRDHSGSVVSEPCVCANWDFECDYGYERHGESQCVPAFWYNPASPSKD
CSLGQSYLNSTGYRRIVSNNCTDGLREKYTAKAQMCPGKAPRGLHVVTTDGRLVAEQGHN
ATFIILMEEGDLQRTNIQLDFGDGIAVSYANFSPIEDGIKHVYKSAGIFQVTAYAENNLG
SDTAVLFLHVVCPVEHVHLRVPFVAIRNKEVNISAVVWPSQLGTLTYFWWFGNSTKPLIT
LDSSISFTFLAEGTDTITVQVAAGNALIQDTKEIAVHEYFQSQLLSFSPNLDYHNPDIPE
WRKDIGNVIKRALVKVTSVPEDQILIAVFPGLPTSAELFILPPKNLTERRKGNEGDLEQI
VETLFNALNQNLVQFELKPGVQVIVYVTQLTLAPLVDSSAGHSSSAMLMLLSVVFVGLAV
FLIYKFKRKIPWINIYAQVQHDKEQEMIGSVSQSENAPKITLSDFTEPEELLDKELDTRV
IGGIATIANSESTKEIPNCTSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q17R88	0.767	0.767	0.000	1222	0.999	0.999	Q17R88.pdb.gz	Q17R88_HUMAN Sortilin-related VPS10 domain containing receptor 3 OS=Homo sapiens OX=9606 GN=SORCS3 PE=2 SV=1
2	AFDB:Q8WY21	0.772	0.807	0.000	1168	0.610	0.638	Q8WY21.pdb.gz	SORC1_HUMAN VPS10 domain-containing receptor SorCS1 OS=Homo sapiens OX=9606 GN=SORCS1 PE=1 SV=3
3	AFDB:Q9EPR5	0.716	0.753	0.000	1159	0.402	0.424	Q9EPR5.pdb.gz	SORC2_MOUSE VPS10 domain-containing receptor SorCS2 OS=Mus musculus OX=10090 GN=Sorcs2 PE=1 SV=2
4	PDB:5nmtB	0.444	0.798	3.602E-39	657	0.124	0.230	5nmtB.pdb.gz
5	AFDB:Q9VXM0	0.102	0.068	4.246E-11	2009	0.118	0.072	Q9VXM0.pdb.gz	Q9VXM0_DROME LDL receptor related protein 4, isoform B OS=Drosophila melanogaster OX=7227 GN=Lrp4 PE=4 SV=1
6	AFDB:Q5VV43	0.080	0.089	2.148E-10	1072	0.108	0.123	Q5VV43.pdb.gz	K0319_HUMAN Dyslexia-associated protein KIAA0319 OS=Homo sapiens OX=9606 GN=KIAA0319 PE=1 SV=1
7	PDB:5a42A	0.068	0.056	3.740E-10	1597	0.086	0.066	5a42A.pdb.gz
8	PDB:7eebE	0.122	0.137	9.055E-10	1053	0.074	0.086	7eebE.pdb.gz	Structure of a mammalian sperm cation channel complex.
9	AFDB:Q8IZA0	0.086	0.097	3.203E-9	1049	0.099	0.115	Q8IZA0.pdb.gz	K319L_HUMAN Dyslexia-associated protein KIAA0319-like protein OS=Homo sapiens OX=9606 GN=KIAA0319L PE=1 SV=2
10	PDB:4g1eA	0.126	0.148	4.581E-9	964	0.079	0.100	4g1eA.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
11	PDB:7nxdA	0.142	0.174	4.811E-9	905	0.079	0.106	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
12	PDB:6vxkB	0.122	0.161	1.489E-8	747	0.063	0.103	6vxkB.pdb.gz
13	PDB:6h03A	0.073	0.073	1.726E-8	1223	0.080	0.080	6h03A.pdb.gz
14	PDB:7mq8LT	0.124	0.162	4.179E-8	869	0.064	0.090	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:6n8sA	0.142	0.188	8.731E-8	834	0.079	0.116	6n8sA.pdb.gz
16	PDB:5wyjBA	0.132	0.195	9.171E-8	755	0.051	0.082	5wyjBA.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
17	AFDB:Q6NY23	0.096	0.133	1.552E-7	807	0.055	0.083	Q6NY23.pdb.gz	Q6NY23_DANRE Kin of IRRE like (Drosophila) OS=Danio rerio OX=7955 GN=kirrel PE=1 SV=1
18	AFDB:A0A0R4IP15	0.088	0.077	4.805E-7	1428	0.124	0.106	A0A0R4IP15.pdb.gz	A0A0R4IP15_DANRE Neogenin 1a OS=Danio rerio OX=7955 GN=cb333 PE=1 SV=1
19	AFDB:Q9VAF5	0.087	0.070	1.284E-6	1706	0.097	0.070	Q9VAF5.pdb.gz	CAD99_DROME Cadherin-99C OS=Drosophila melanogaster OX=7227 GN=Cad99C PE=1 SV=2
20	AFDB:F1R2D2	0.102	0.079	2.204E-6	1687	0.110	0.080	F1R2D2.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B5MED8	0.0	890	987	0.353	0.437	B5MED8_HUMAN Sortilin related VPS10 domain containing receptor 2 OS=Homo sapiens OX=9606 GN=SORCS2 PE=1 SV=4
2	Q17R88	0.0	2538	1222	0.999	0.999	Q17R88_HUMAN Sortilin-related VPS10 domain containing receptor 3 OS=Homo sapiens OX=9606 GN=SORCS3 PE=2 SV=1
3	Q8VI51	0.0	2314	1219	0.924	0.926	SORC3_MOUSE VPS10 domain-containing receptor SorCS3 OS=Mus musculus OX=10090 GN=Sorcs3 PE=1 SV=1
4	Q8WY21	0.0	1550	1168	0.590	0.617	SORC1_HUMAN VPS10 domain-containing receptor SorCS1 OS=Homo sapiens OX=9606 GN=SORCS1 PE=1 SV=3
5	Q96PQ0	0.0	962	1159	0.384	0.405	SORC2_HUMAN VPS10 domain-containing receptor SorCS2 OS=Homo sapiens OX=9606 GN=SORCS2 PE=1 SV=3
6	Q9EPR5	0.0	974	1159	0.398	0.419	SORC2_MOUSE VPS10 domain-containing receptor SorCS2 OS=Mus musculus OX=10090 GN=Sorcs2 PE=1 SV=2
7	Q9JLC4	0.0	1534	1167	0.580	0.608	SORC1_MOUSE VPS10 domain-containing receptor SorCS1 OS=Mus musculus OX=10090 GN=Sorcs1 PE=1 SV=1
8	Q9UPU3	0.0	2540	1222	1.000	1.000	SORC3_HUMAN VPS10 domain-containing receptor SorCS3 OS=Homo sapiens OX=9606 GN=SORCS3 PE=1 SV=2
9	P0DSP1	4.74e-73	270	2215	0.173	0.095	SORL_RAT Sortilin-related receptor OS=Rattus norvegicus OX=10116 GN=Sorl1 PE=1 SV=1
10	O88307	2.96e-71	265	2215	0.173	0.095	SORL_MOUSE Sortilin-related receptor OS=Mus musculus OX=10090 GN=Sorl1 PE=1 SV=3
11	Q92673	1.96e-69	259	2214	0.165	0.091	SORL_HUMAN Sortilin-related receptor OS=Homo sapiens OX=9606 GN=SORL1 PE=1 SV=2
12	Q95209	1.65e-68	256	2213	0.162	0.089	SORL_RABIT Sortilin-related receptor OS=Oryctolagus cuniculus OX=9986 GN=SORL1 PE=1 SV=1
13	Q6PHU5	1.58e-57	216	825	0.150	0.222	SORT_MOUSE Sortilin OS=Mus musculus OX=10090 GN=Sort1 PE=1 SV=1
14	O54861	8.27e-57	214	825	0.149	0.221	SORT_RAT Sortilin OS=Rattus norvegicus OX=10116 GN=Sort1 PE=1 SV=3
15	Q99523	4.59e-56	212	831	0.134	0.197	SORT_HUMAN Sortilin OS=Homo sapiens OX=9606 GN=SORT1 PE=1 SV=3
16	E1BKZ9	3.13e-55	210	876	0.136	0.189	E1BKZ9_BOVIN Sortilin 1 OS=Bos taurus OX=9913 GN=SORT1 PE=4 SV=2
17	A5PMG8	1.21e-51	199	828	0.134	0.198	A5PMG8_DANRE Sortilin 1b OS=Danio rerio OX=7955 GN=sort1 PE=1 SV=1
18	Q8IKV8	1.60e-43	174	895	0.142	0.193	Q8IKV8_PLAF7 Sortilin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1451800 PE=3 SV=1
19	O42930	2.64e-32	139	1466	0.141	0.117	VPS10_SCHPO Vacuolar protein sorting/targeting protein 10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps10 PE=1 SV=1
20	P32319	5.92e-32	138	1579	0.100	0.077	VPS10_YEAST Vacuolar protein sorting/targeting protein VPS10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PEP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15899 BNR_6	4.1e+02	12.6	BNR-Asp box repeat
2	PF00801 PKD	2.3e-12	57.9	PKD domain
3	PF18911 PKD_4	0.0073	27.7	PKD domain
4	PF15902 Sortilin-Vps10	1.8e-97	338.6	Sortilin, neurotensin receptor 3,
5	PF15901 Sortilin_C	6.6e-33	125.9	Sortilin, neurotensin receptor 3, C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358715

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000299138	0.797	Vacuolar protein sorting-associated protein 35
2	9606.ENSP00000339844	0.768	Mitochondrial ribosomal protein L43
3	9606.ENSP00000358525	0.688	Beta-nerve growth factor
4	9606.ENSP00000322270	0.667	Adhesion G protein-coupled receptor L2
5	9606.ENSP00000366586	0.662	Zinc transporter ZIP12
6	9606.ENSP00000271332	0.655	Cadherin EGF LAG seven-pass G-type receptor 2
7	9606.ENSP00000358925	0.646	Proline/serine-rich coiled-coil protein 1
8	9606.ENSP00000362480	0.599	Vacuolar protein sorting-associated protein 26A
9	9606.ENSP00000405388	0.545	Carbonic anhydrase-related protein 10
10	9606.ENSP00000360268	0.541	Delta-1-pyrroline-5-carboxylate synthase
11	9606.ENSP00000281187	0.532	Vacuolar protein sorting-associated protein 26B
12	9606.ENSP00000480853	0.522	Vacuolar protein sorting-associated protein 29
13	9606.ENSP00000064571	0.521	Cerebellin-4
14	9606.ENSP00000382428	0.512	Disks large homolog 4
15	9606.ENSP00000358001	0.507	Transforming acidic coiled-coil-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0023051	0.983	regulation of signaling
GO:0010646	0.983	regulation of cell communication
GO:0050804	0.970	modulation of chemical synaptic transmission
GO:0032501	0.969	multicellular organismal process
GO:0048167	0.954	regulation of synaptic plasticity
GO:0050890	0.905	cognition
GO:0009987	0.869	cellular process
GO:0007610	0.864	behavior
GO:0051234	0.626	establishment of localization
GO:0006810	0.573	transport
GO:0007613	0.544	memory
GO:0007612	0.499	learning
GO:0051641	0.316	cellular localization
GO:0050896	0.310	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0043226	0.890	organelle
GO:0043227	0.708	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]