StarFunc result for job id Q9UPU5

User Input

>input (2620 residues)
MESEEEQHMTTLLCMGFSDPATIRKALRLAKNDINEAVALLTNERPGLDYGGYEPMDSGG
GPSPGPGGGPRGDGGGDGGGGGPSRGGSTGGGGGFDPPPAYHEVVDAEKNDENGNCSGEG
IEFPTTNLYELESRVLTDHWSIPYKREESLGKCLLASTYLARLGLSESDENCRRFMDRCM
PEAFKKLLTSSAVHKWGTEIHEGIYNMLMLLIELVAERIKQDPIPTGLLGVLTMAFNPDN
EYHFKNRMKVSQRNWAEVFGEGNMFAVSPVSTFQKEPHGWVVDLVNKFGELGGFAAIQAK
LHSEDIELGAVSALIQPLGVCAEYLNSSVVQPMLDPVILTTIQDVRSVEEKDLKDKRLVS
IPELLSAVKLLCMRFQPDLVTIVDDLRLDILLRMLKSPHFSAKMNSLKEVTKLIEDSTLS
KSVKNAIDTDRLLDWLVENSVLSIALEGNIDQAQYCDRIKGIIELLGSKLSLDELTKIWK
IQSGQSSTVIENIHTIIAAAAVKFNSDQLNHLFVLIQKSWETESDRVRQKLLSLIGRIGR
EARFETTSGKVLDVLWELAHLPTLPSSLIQQALEEHLTILSDAYAVKEAIKRSYIIKCIE
DIKRPGEWSGLEKNKKDGFKSSQLNNPQFVWVVPALRQLHEITRSFIKQTYQKQDKSIIQ
DLKKNFEIVKLVTGSLIACHRLAAAVAGPGGLSGSTLVDGRYTYREYLEAHLKFLAFFLQ
EATLYLGWNRAKEIWECLVTGQDVCELDREMCFEWFTKGQHDLESDVQQQLFKEKILKLE
SYEITMNGFNLFKTFFENVNLCDHRLKRQGAQLYVEKLELIGMDFIWKIAMESPDEEIAN
EAIQLIINYSYINLNPRLKKDSVSLHKKFIADCYTRLEAASSALGGPTLTHAVTRATKML
TATAMPTVATSVQSPYRSTKLVIIERLLLLAERYVITIEDFYSVPRTILPHGASFHGHLL
TLNVTYESTKDTFTVEAHSNETIGSVRWKIAKQLCSPVDNIQIFTNDSLLTVNKDQKLLH
QLGFSDEQILTVKTSGSGTPSGSSADSSTSSSSSSSGVFSSSYAMEQEKSLPGVVMALVC
NVFDMLYQLANLEEPRITLRVRKLLLLIPTDPAIQEALDQLDSLGRKKTLLSESSSQSSK
SPSLSSKQQHQPSASSILESLFRSFAPGMSTFRVLYNLEVLSSKLMPTADDDMARSCAKS
FCENFLKAGGLSLVVNVMQRDSIPSEVDYETRQGVYSICLQLARFLLVGQTMPTLLDEDL
TKDGIEALSSRPFRNVSRQTSRQMSLCGTPEKSSYRQLSVSDRSSIRVEEIIPAARVAIQ
TMEVSDFTSTVACFMRLSWAAAAGRLDLVGSSQPIKESNSLCPAGIRNRLSSSGSNCSSG
SEGEPVALHAGICVRQQSVSTKDSLIAGEALSLLVTCLQLRSQQLASFYNLPCVADFIID
ILLGSPSAEIRRVACDQLYTLSQTDTSAHPDVQKPNQFLLGVILTAQLPLWSPTSIMRGV
NQRLLSQCMEYFDLRCQLLDDLTTSEMEQLRISPATMLEDEITWLDNFEPNRTAECETSE
ADNILLAGHLRLIKTLLSLCGAEKEMLGSSLIKPLLDDFLFRASRIILNSHSPAGSAAIS
QQDFHPKCSTANSRLAAYEVLVMLADSSPSNLQIIIKELLSMHHQPDPALTKEFDYLPPV
DSRSSSGFVGLRNGGATCYMNAVFQQLYMQPGLPESLLSVDDDTDNPDDSVFYQVQSLFG
HLMESKLQYYVPENFWKIFKMWNKELYVREQQDAYEFFTSLIDQMDEYLKKMGRDQIFKN
TFQGIYSDQKICKDCPHRYEREEAFMALNLGVTSCQSLEISLDQFVRGEVLEGSNAYYCE
KCKEKRITVKRTCIKSLPSVLVIHLMRFGFDWESGRSIKYDEQIRFPWMLNMEPYTVSGM
ARQDSSSEVGENGRSVDQGGGGSPRKKVALTENYELVGVIVHSGQAHAGHYYSFIKDRRG
CGKGKWYKFNDTVIEEFDLNDETLEYECFGGEYRPKVYDQTNPYTDVRRRYWNAYMLFYQ
RVSDQNSPVLPKKSRVSVVRQEAEDLSLSAPSSPEISPQSSPRPHRPNNDRLSILTKLVK
KGEKKGLFVEKMPARIYQMVRDENLKFMKNRDVYSSDYFSFVLSLASLNATKLKHPYYPC
MAKVSLQLAIQFLFQTYLRTKKKLRVDTEEWIATIEALLSKSFDACQWLVEYFISSEGRE
LIKIFLLECNVREVRVAVATILEKTLDSALFYQDKLKSLHQLLEVLLALLDKDVPENCKN
CAQYFFLFNTFVQKQGIRAGDLLLRHSALRHMISFLLGASRQNNQIRRWSSAQAREFGNL
HNTVALLVLHSDVSSQRNVAPGIFKQRPPISIAPSSPLLPLHEEVEALLFMSEGKPYLLE
VMFALRELTGSLLALIEMVVYCCFCNEHFSFTMLHFIKNQLETAPPHELKNTFQLLHEIL
VIEDPIQVERVKFVFETENGLLALMHHSNHVDSSRCYQCVKFLVTLAQKCPAAKEYFKEN
SHHWSWAVQWLQKKMSEHYWTPQSNVSNETSTGKTFQRTISAQDTLAYATALLNEKEQSG
SSNGSESSPANENGDRHLQQGSESPMMIGELRSDLDDVDP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1Q6K1	0.813	0.812	0.000	2621	0.821	0.821	F1Q6K1.pdb.gz	F1Q6K1_DANRE Ubiquitin carboxyl-terminal hydrolase 24 isoform X1 OS=Danio rerio OX=7955 GN=usp24 PE=1 SV=2
2	AFDB:P70398	0.640	0.653	0.000	2559	0.298	0.306	P70398.pdb.gz	USP9X_MOUSE Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Mus musculus OX=10090 GN=Usp9x PE=1 SV=2
3	AFDB:Q9UPU5	1.000	1.000	0.000	2620	1.000	1.000	Q9UPU5.pdb.gz	UBP24_HUMAN Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens OX=9606 GN=USP24 PE=1 SV=3
4	PDB:7yxxA	0.457	0.643	1.155E-78	1754	0.226	0.338	7yxxA.pdb.gz
5	AFDB:Q09879	0.116	0.265	1.210E-19	1108	0.036	0.086	Q09879.pdb.gz	UBP72_SCHPO Ubiquitin carboxyl-terminal hydrolase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp5 PE=1 SV=3
6	AFDB:E7EY58	0.131	0.295	1.506E-19	1092	0.055	0.131	E7EY58.pdb.gz
7	AFDB:Q22240	0.117	0.227	2.419E-19	1326	0.041	0.081	Q22240.pdb.gz	Q22240_CAEEL Ubiquitin carboxyl-terminal hydrolase 47 OS=Caenorhabditis elegans OX=6239 GN=CELE_T05H10.1 PE=1 SV=2
8	AFDB:Q8BY87	0.121	0.224	2.419E-19	1376	0.039	0.073	Q8BY87.pdb.gz	UBP47_MOUSE Ubiquitin carboxyl-terminal hydrolase 47 OS=Mus musculus OX=10090 GN=Usp47 PE=1 SV=2
9	AFDB:Q24574	0.117	0.193	3.010E-19	1556	0.043	0.073	Q24574.pdb.gz	UBPE_DROME Ubiquitin carboxyl-terminal hydrolase 47 OS=Drosophila melanogaster OX=7227 GN=Usp47 PE=1 SV=2
10	AFDB:Q9FPT1	0.118	0.269	3.358E-19	1116	0.040	0.095	Q9FPT1.pdb.gz	UBP12_ARATH Ubiquitin C-terminal hydrolase 12 OS=Arabidopsis thaliana OX=3702 GN=UBP12 PE=1 SV=2
11	AFDB:Q9UTT1	0.116	0.261	7.769E-19	1129	0.039	0.089	Q9UTT1.pdb.gz	UBP71_SCHPO Ubiquitin carboxyl-terminal hydrolase 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp15 PE=1 SV=2
12	PDB:5cvnB	0.108	0.786	1.337E-16	321	0.034	0.277	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
13	PDB:3mhsA	0.103	0.550	2.860E-15	455	0.037	0.211	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
14	PDB:5k16B	0.101	0.695	6.379E-15	328	0.034	0.268	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
15	PDB:7w3ax	0.105	0.508	8.191E-14	494	0.029	0.152	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
16	PDB:8a9kD	0.098	0.793	1.460E-12	285	0.027	0.249	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
17	PDB:7ay1D	0.105	0.713	4.864E-12	341	0.030	0.229	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
18	PDB:7qo48	0.104	0.644	5.427E-12	372	0.028	0.199	7qo48.pdb.gz	Allosteric control of Ubp6 and the proteasome via a bidirectional switch.
19	PDB:4wa6D	0.088	0.515	7.005E-12	415	0.033	0.210	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
20	PDB:5gjqx	0.102	0.652	9.041E-12	355	0.026	0.189	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1Q6K1	0.0	4344	2621	0.822	0.822	F1Q6K1_DANRE Ubiquitin carboxyl-terminal hydrolase 24 isoform X1 OS=Danio rerio OX=7955 GN=usp24 PE=1 SV=2
2	O00507	0.0	990	2555	0.303	0.311	USP9Y_HUMAN Probable ubiquitin carboxyl-terminal hydrolase FAF-Y OS=Homo sapiens OX=9606 GN=USP9Y PE=2 SV=2
3	P55824	0.0	892	2778	0.287	0.271	FAF_DROME Probable ubiquitin carboxyl-terminal hydrolase FAF OS=Drosophila melanogaster OX=7227 GN=faf PE=1 SV=2
4	P70398	0.0	981	2559	0.309	0.317	USP9X_MOUSE Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Mus musculus OX=10090 GN=Usp9x PE=1 SV=2
5	Q93008	0.0	985	2554	0.310	0.318	USP9X_HUMAN Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens OX=9606 GN=USP9X PE=1 SV=4
6	Q9UPU5	0.0	5438	2620	1.000	1.000	UBP24_HUMAN Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens OX=9606 GN=USP24 PE=1 SV=3
7	Q70CQ2	7.34e-66	252	3546	0.072	0.053	UBP34_HUMAN Ubiquitin carboxyl-terminal hydrolase 34 OS=Homo sapiens OX=9606 GN=USP34 PE=1 SV=2
8	A0A0B4LIK5	1.12e-63	245	3921	0.060	0.040	A0A0B4LIK5_DROME ubiquitinyl hydrolase 1 OS=Drosophila melanogaster OX=7227 GN=puf PE=1 SV=1
9	A0A0B4KHF3	1.16e-63	245	3921	0.060	0.040	A0A0B4KHF3_DROME ubiquitinyl hydrolase 1 OS=Drosophila melanogaster OX=7227 GN=puf PE=1 SV=1
10	A0A0B4KI06	1.18e-63	245	3930	0.060	0.040	A0A0B4KI06_DROME ubiquitinyl hydrolase 1 OS=Drosophila melanogaster OX=7227 GN=puf PE=1 SV=1
11	Q9VC56	1.22e-63	245	3912	0.060	0.040	PUF_DROME Ubiquitin carboxyl-terminal hydrolase puf OS=Drosophila melanogaster OX=7227 GN=puf PE=1 SV=2
12	Q8IMW2	1.30e-63	244	3912	0.060	0.040	Q8IMW2_DROME ubiquitinyl hydrolase 1 OS=Drosophila melanogaster OX=7227 GN=puf PE=1 SV=2
13	Q24574	1.92e-37	158	1556	0.045	0.076	UBPE_DROME Ubiquitin carboxyl-terminal hydrolase 47 OS=Drosophila melanogaster OX=7227 GN=Usp47 PE=1 SV=2
14	Q84WU2	1.49e-33	144	1115	0.045	0.106	UBP13_ARATH Ubiquitin C-terminal hydrolase 13 OS=Arabidopsis thaliana OX=3702 GN=UBP13 PE=1 SV=1
15	Q86UV5	1.65e-33	144	1035	0.044	0.111	UBP48_HUMAN Ubiquitin carboxyl-terminal hydrolase 48 OS=Homo sapiens OX=9606 GN=USP48 PE=1 SV=1
16	Q9FPT1	2.79e-33	144	1116	0.046	0.108	UBP12_ARATH Ubiquitin C-terminal hydrolase 12 OS=Arabidopsis thaliana OX=3702 GN=UBP12 PE=1 SV=2
17	Q9UTT1	1.14e-32	142	1129	0.042	0.098	UBP71_SCHPO Ubiquitin carboxyl-terminal hydrolase 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp15 PE=1 SV=2
18	Q8BY87	1.30e-32	142	1376	0.038	0.072	UBP47_MOUSE Ubiquitin carboxyl-terminal hydrolase 47 OS=Mus musculus OX=10090 GN=Usp47 PE=1 SV=2
19	Q96K76	3.08e-32	140	1375	0.039	0.073	UBP47_HUMAN Ubiquitin carboxyl-terminal hydrolase 47 OS=Homo sapiens OX=9606 GN=USP47 PE=1 SV=3
20	A0A0R4IB93	1.69e-31	138	1047	0.043	0.107	UBP48_DANRE Ubiquitin carboxyl-terminal hydrolase 48 OS=Danio rerio OX=7955 GN=usp48 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12030 DUF3517	0.00098	29.5	Domain of unknown function (DUF3517)
2	PF15601 Imm70	3.9e+02	12.1	Immunity protein 70
3	PF00627 UBA	10	17.4	UBA/TS-N domain
4	PF00240 ubiquitin	4.9e+02	11.9	Ubiquitin family
5	PF00443 UCH	1.3e-45	167.7	Ubiquitin carboxyl-terminal hydrolase
6	PF13423 UCH_1	1.1e-18	79.5	Ubiquitin carboxyl-terminal hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000294383

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256996	0.951	DNA damage-binding protein 2
2	9606.ENSP00000457411	0.937	Ubiquitin carboxyl-terminal hydrolase 10
3	9606.ENSP00000301962	0.925	Ubiquitin carboxyl-terminal hydrolase 42
4	9606.ENSP00000360381	0.904	CUB domain containing protein 2
5	9606.ENSP00000361664	0.782	Transcription factor HIVEP3
6	9606.ENSP00000349594	0.767	ELAV-like protein 4
7	9606.ENSP00000269305	0.744	Cellular tumor antigen p53
8	9606.ENSP00000353575	0.721	Translation initiation factor eIF-2B subunit gamma
9	9606.ENSP00000384160	0.706	RNA-binding protein 33
10	9606.ENSP00000360262	0.697	FGGY carbohydrate kinase domain containing
11	9606.ENSP00000231948	0.677	Protein cereblon
12	9606.ENSP00000352069	0.624	NEDD4-like E3 ubiquitin-protein ligase WWP2
13	9606.ENSP00000229268	0.600	Ubiquitin carboxyl-terminal hydrolase 5
14	9606.ENSP00000373696	0.596	E3 ubiquitin-protein ligase TRIP12
15	9606.ENSP00000263966	0.552	Ubiquitin carboxyl-terminal hydrolase 13
16	9606.ENSP00000343535	0.541	Ubiquitin carboxyl-terminal hydrolase 7
17	9606.ENSP00000261601	0.532	Ubiquitin carboxyl-terminal hydrolase 14
18	9606.ENSP00000444357	0.524	Ubiquitin thioesterase OTUB1
19	9606.ENSP00000251157	0.510	Dedicator of cytokinesis protein 7
20	9606.ENSP00000361306	0.506	Cysteine protease ATG4A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004843	1.000	cysteine-type deubiquitinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.993	primary metabolic process
GO:0006807	0.987	nitrogen compound metabolic process
GO:0043170	0.985	macromolecule metabolic process
GO:0070646	0.975	protein modification by small protein removal
GO:0016579	0.963	protein deubiquitination
GO:0009987	0.797	cellular process
GO:0032502	0.749	developmental process
GO:0065007	0.715	biological regulation
GO:0050789	0.708	regulation of biological process
GO:0050794	0.687	regulation of cellular process
GO:0032501	0.686	multicellular organismal process
GO:0048856	0.665	anatomical structure development
GO:0007275	0.587	multicellular organism development
GO:0007399	0.520	nervous system development
GO:0044237	0.474	cellular metabolic process
GO:0009653	0.319	anatomical structure morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.964	cytosol
GO:0016020	0.384	membrane
GO:0032991	0.378	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.

[back to server]