StarFunc result for job id Q9UPU7

User Input

>input (963 residues)
MPGAGARAEEGGGGGEGAAQGAAAEPGAGPAREPARLCGYLQKLSGKGPLRGYRSRWFVF
DARRCYLYYFKSPQDALPLGHLDIADACFSYQGPDEAAEPGTEPPAHFQVHSAGAVTVLK
APNRQLMTYWLQELQQKRWEYCNSLDMVKWDSRTSPTPGDFPKGLVARDNTDLIYPHPNA
SAEKARNVLAVETVPGELVGEQAANQPAPGHPNSINFYSLKQWGNELKNSMSSFRPGRGH
NDSRRTVFYTNEEWELLDPTPKDLEESIVQEEKKKLTPEGNKGVTGSGFPFDFGRNPYKG
KRPLKDIIGSYKNRHSSGDPSSEGTSGSGSVSIRKPASEMQLQVQSQQEELEQLKKDLSS
QKELVRLLQQTVRSSQYDKYFTSSRLCEGVPKDTLELLHQKDDQILGLTSQLERFSLEKE
SLQQEVRTLKSKVGELNEQLGMLMETIQAKDEVIIKLSEGEGNGPPPTVAPSSPSVVPVA
RDQLELDRLKDNLQGYKTQNKFLNKEILELSALRRNAERRERDLMAKYSSLEAKLCQIES
KYLILLQEMKTPVCSEDQGPTREVIAQLLEDALQVESQEQPEQAFVKPHLVSEYDIYGFR
TVPEDDEEEKLVAKVRALDLKTLYLTENQEVSTGVKWENYFASTVNREMMCSPELKNLIR
AGIPHEHRSKVWKWCVDRHTRKFKDNTEPGHFQTLLQKALEKQNPASKQIELDLLRTLPN
NKHYSCPTSEGIQKLRNVLLAFSWRNPDIGYCQGLNRLVAVALLYLEQEDAFWCLVTIVE
VFMPRDYYTKTLLGSQVDQRVFRDLMSEKLPRLHGHFEQYKVDYTLITFNWFLVVFVDSV
VSDILFKIWDSFLYEGPKVIFRFALALFKYKEEEILKLQDSMSIFKYLRYFTRTILDARK
LISISFGDLNPFPLRQIRNRRAYHLEKVRLELTELEAIREDFLRERDTSPDKGELVSDEE
EDT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UPU7	1.000	1.000	0.000	963	1.000	1.000	Q9UPU7.pdb.gz	TBD2B_HUMAN TBC1 domain family member 2B OS=Homo sapiens OX=9606 GN=TBC1D2B PE=1 SV=2
2	AFDB:Q9BYX2	0.358	0.372	1.509E-61	928	0.390	0.405	Q9BYX2.pdb.gz	TBD2A_HUMAN TBC1 domain family member 2A OS=Homo sapiens OX=9606 GN=TBC1D2 PE=1 SV=3
3	AFDB:Q23419	0.336	0.355	7.650E-44	908	0.267	0.283	Q23419.pdb.gz	Q23419_CAEEL PH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tbc-2 PE=1 SV=2
4	AFDB:Q8VCZ6	0.313	0.397	3.448E-21	750	0.126	0.161	Q8VCZ6.pdb.gz	SGSM3_MOUSE Small G protein signaling modulator 3 OS=Mus musculus OX=10090 GN=Sgsm3 PE=1 SV=1
5	AFDB:Q86TI0	0.282	0.236	2.160E-17	1168	0.157	0.129	Q86TI0.pdb.gz	TBCD1_HUMAN TBC1 domain family member 1 OS=Homo sapiens OX=9606 GN=TBC1D1 PE=1 SV=2
6	AFDB:Q9VGL8	0.280	0.704	5.770E-17	363	0.093	0.248	Q9VGL8.pdb.gz	TBWKD_DROME TBC1 domain family member whacked OS=Drosophila melanogaster OX=7227 GN=wkd PE=1 SV=1
7	AFDB:D3ZGN0	0.281	0.211	9.904E-17	1309	0.145	0.107	D3ZGN0.pdb.gz	D3ZGN0_RAT TBC1 domain family, member 4 OS=Rattus norvegicus OX=10116 GN=Tbc1d4 PE=1 SV=4
8	AFDB:O94711	0.307	0.405	2.173E-16	720	0.106	0.142	O94711.pdb.gz	GYP2_SCHPO GTPase-activating protein gyp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gyp2 PE=3 SV=1
9	AFDB:O43048	0.292	0.336	3.730E-16	834	0.092	0.107	O43048.pdb.gz	YH51_SCHPO TBC domain-containing protein C215.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC215.01 PE=3 SV=4
10	AFDB:P53258	0.300	0.304	1.982E-15	950	0.096	0.097	P53258.pdb.gz	GYP2_YEAST GTPase-activating protein GYP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDR1 PE=1 SV=1
11	PDB:3ljuX	0.089	0.218	1.521E-4	373	0.027	0.070	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
12	PDB:4z6yA	0.192	0.574	4.266E-4	273	0.054	0.190	4z6yA.pdb.gz
13	PDB:7c3mA	0.086	0.137	8.484E-4	577	0.030	0.050	7c3mA.pdb.gz
14	PDB:4mk0A	0.094	0.139	1.387E-3	631	0.020	0.030	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
15	PDB:6bbpA	0.087	0.154	1.607E-3	520	0.026	0.048	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
16	PDB:4iapA	0.077	0.279	2.054E-3	256	0.021	0.078	4iapA.pdb.gz
17	PDB:6hhgA	0.086	0.200	2.758E-3	386	0.025	0.062	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
18	PDB:6u3eA	0.081	0.188	4.507E-3	397	0.025	0.060	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
19	PDB:6s9wA	0.087	0.188	1.091E-2	411	0.024	0.056	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
20	PDB:7rx9A	0.092	0.194	1.783E-2	432	0.022	0.049	7rx9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9JW56	0.0	590	291	0.294	0.973	C9JW56_HUMAN TBC1 domain family member 2B (Fragment) OS=Homo sapiens OX=9606 GN=TBC1D2B PE=1 SV=1
2	Q9BYX2	0.0	633	928	0.404	0.419	TBD2A_HUMAN TBC1 domain family member 2A OS=Homo sapiens OX=9606 GN=TBC1D2 PE=1 SV=3
3	Q9UPU7	0.0	1991	963	1.000	1.000	TBD2B_HUMAN TBC1 domain family member 2B OS=Homo sapiens OX=9606 GN=TBC1D2B PE=1 SV=2
4	Q23419	2.31e-92	315	908	0.204	0.216	Q23419_CAEEL PH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tbc-2 PE=1 SV=2
5	Q96HU1	3.02e-55	207	749	0.136	0.175	SGSM3_HUMAN Small G protein signaling modulator 3 OS=Homo sapiens OX=9606 GN=SGSM3 PE=1 SV=1
6	Q8VCZ6	8.88e-53	200	750	0.126	0.161	SGSM3_MOUSE Small G protein signaling modulator 3 OS=Mus musculus OX=10090 GN=Sgsm3 PE=1 SV=1
7	P53258	2.93e-46	182	950	0.090	0.092	GYP2_YEAST GTPase-activating protein GYP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDR1 PE=1 SV=1
8	Q6ZT07	8.02e-39	159	1266	0.103	0.078	TBCD9_HUMAN TBC1 domain family member 9 OS=Homo sapiens OX=9606 GN=TBC1D9 PE=2 SV=2
9	O43048	6.72e-37	152	834	0.088	0.102	YH51_SCHPO TBC domain-containing protein C215.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC215.01 PE=3 SV=4
10	O94711	1.76e-36	150	720	0.085	0.114	GYP2_SCHPO GTPase-activating protein gyp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gyp2 PE=3 SV=1
11	O95759	1.25e-35	149	1140	0.089	0.075	TBCD8_HUMAN TBC1 domain family member 8 OS=Homo sapiens OX=9606 GN=TBC1D8 PE=1 SV=3
12	Q0IIM8	1.54e-35	148	1120	0.083	0.071	TBC8B_HUMAN TBC1 domain family member 8B OS=Homo sapiens OX=9606 GN=TBC1D8B PE=1 SV=2
13	B0R0W9	1.19e-34	145	1108	0.087	0.076	TBC8B_DANRE TBC1 domain family member 8B OS=Danio rerio OX=7955 GN=tbc1d8b PE=1 SV=1
14	Q66K14	3.99e-34	144	1250	0.088	0.068	TBC9B_HUMAN TBC1 domain family member 9B OS=Homo sapiens OX=9606 GN=TBC1D9B PE=1 SV=3
15	A1L3A9	4.59e-34	144	1232	0.088	0.069	A1L3A9_HUMAN TBC1 domain family, member 9B (With GRAM domain) OS=Homo sapiens OX=9606 GN=TBC1D9B PE=1 SV=1
16	Q8C9V1	8.20e-34	138	444	0.088	0.191	TB10C_MOUSE Carabin OS=Mus musculus OX=10090 GN=Tbc1d10c PE=1 SV=1
17	Q8IV04	1.18e-33	137	446	0.080	0.173	TB10C_HUMAN Carabin OS=Homo sapiens OX=9606 GN=TBC1D10C PE=1 SV=1
18	P87234	7.58e-33	138	635	0.103	0.156	GYP3_SCHPO GTPase-activating protein gyp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gyp3 PE=1 SV=1
19	Q4KMP7	5.84e-31	133	808	0.075	0.089	TB10B_HUMAN TBC1 domain family member 10B OS=Homo sapiens OX=9606 GN=TBC1D10B PE=1 SV=3
20	Q9BXI6	6.94e-30	127	508	0.108	0.205	TB10A_HUMAN TBC1 domain family member 10A OS=Homo sapiens OX=9606 GN=TBC1D10A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07889 DUF1664	89	14.6	Protein of unknown function (DUF1664)
2	PF16043 DUF4795	2.1e+02	12.8	Domain of unknown function (DUF4795)
3	PF16515 HIP1_clath_bdg	56	15.5	Clathrin-binding domain of Huntingtin-interacting protein 1
4	PF01352 KRAB	27	15.8	KRAB box
5	PF08537 NBP1	43	15.0	Fungal Nap binding protein NBP1
6	PF00169 PH	0.0015	30.3	PH domain
7	PF15409 PH_8	58	15.4	Pleckstrin homology domain
8	PF00566 RabGAP-TBC	1e-54	197.0	Rab-GTPase-TBC domain
9	PF17082 Spc29	3.8e+02	12.3	Spindle Pole Component 29

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300584

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296473	0.688	Vacuolar fusion protein MON1 homolog A
2	9606.ENSP00000365962	0.678	TBC1 domain family member 25
3	9606.ENSP00000313050	0.658	Protein NipSnap homolog 2
4	9606.ENSP00000216121	0.611	Nipsnap homolog 1
5	9606.ENSP00000353549	0.608	Cell division cycle protein 16 homolog
6	9606.ENSP00000459943	0.606	Rabankyrin-5
7	9606.ENSP00000265062	0.599	Ras-related protein Rab-7a
8	9606.ENSP00000363970	0.599	Microtubule-associated proteins 1A/1B light chain 3A
9	9606.ENSP00000248248	0.574	MON1 homolog B, secretory trafficking associated
10	9606.ENSP00000300504	0.558	TBC1 domain family member 21
11	9606.ENSP00000377700	0.550	TBC1 domain family member 23
12	9606.ENSP00000264866	0.542	TBC1 domain family member 19
13	9606.ENSP00000411418	0.510	Rab3 GTPase-activating protein catalytic subunit
14	9606.ENSP00000361731	0.502	TBC1 domain family member 13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.994	protein binding
GO:0019899	0.567	enzyme binding
GO:0030695	0.520	GTPase regulator activity
GO:0005096	0.423	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0016192	0.983	vesicle-mediated transport
GO:0006897	0.819	endocytosis
GO:0009987	0.812	cellular process
GO:0065007	0.790	biological regulation
GO:0050789	0.629	regulation of biological process
GO:0050794	0.511	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005768	0.997	endosome
GO:0005769	0.883	early endosome
GO:0016020	0.881	membrane
GO:0071944	0.432	cell periphery
GO:0005886	0.415	plasma membrane
GO:0070013	0.401	intracellular organelle lumen
GO:0005634	0.360	nucleus
GO:0031981	0.317	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]