StarFunc result for job id Q9UPU9

User Input

>input (718 residues)
MMFRDQVGVLAGWFKGWNECEQTVALLSLLKRVSQTQARFLQLCLEHSLADCAELHVLER
EANSPGIINQWQQESKDKVISLLLTHLPLLKPGNLDAKVEYMKLLPKILAHSIEHNQHIE
ESRQLLSYALIHPATSLEDRSALAMWLNHLEDRTSTSFGGQNRGRSDSVDYGQTHYYHQR
QNSDDKLNGWQNSRDSGICINASNWQDKSMGCENGHVPLYSSSSVPTTINTIGTSTSTIL
SGQAHHSPLKRSVSLTPPMNVPNQPLGHGWMSHEDLRARGPQCLPSDHAPLSPQSSVASS
GSGGSEHLEDQTTARNTFQEEGSGMKDVPAWLKSLRLHKYAALFSQMTYEEMMALTECQL
EAQNVTKGARHKIVISIQKLKERQNLLKSLERDIIEGGSLRIPLQELHQMILTPIKAYSS
PSTTPEARRREPQAPRQPSLMGPESQSPDCKDGAAATGATATPSAGASGGLQPHQLSSCD
GELAVAPLPEGDLPGQFTRVMGKVCTQLLVSRPDEENISSYLQLIDKCLIHEAFTETQKK
RLLSWKQQVQKLFRSFPRKTLLDISGYRQQRNRGFGQSNSLPTAGSVGGGMGRRNPRQYQ
IPSRNVPSARLGLLGTSGFVSSNQRNTTATPTIMKQGRQNLWFANPGGSNSMPSRTHSSV
QRTRSLPVHTSPQNMLMFQQPEFQLPVTEPDINNRLESLCLSMTEHALGDGVDRTSTI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UPU9	1.000	1.000	2.301E-78	718	1.000	1.000	Q9UPU9.pdb.gz	SMAG1_HUMAN Protein Smaug homolog 1 OS=Homo sapiens OX=9606 GN=SAMD4A PE=1 SV=3
2	AFDB:A0A024R0N7	0.307	0.315	4.560E-50	694	0.623	0.644	A0A024R0N7.pdb.gz
3	AFDB:Q8WYQ9	0.093	0.077	5.804E-3	949	0.131	0.099	Q8WYQ9.pdb.gz	ZCH14_HUMAN Zinc finger CCHC domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZCCHC14 PE=1 SV=1
4	AFDB:O60885	0.070	0.041	9.158E-2	1362	0.123	0.065	O60885.pdb.gz	BRD4_HUMAN Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4 PE=1 SV=2
5	AFDB:Q6P1E1	0.117	0.082	1.482E-1	1072	0.124	0.083	Q6P1E1.pdb.gz	ZMIZ1_MOUSE Zinc finger MIZ domain-containing protein 1 OS=Mus musculus OX=10090 GN=Zmiz1 PE=1 SV=1
6	AFDB:Q9Y6J0	0.079	0.032	2.507E-1	2220	0.143	0.046	Q9Y6J0.pdb.gz	CABIN_HUMAN Calcineurin-binding protein cabin-1 OS=Homo sapiens OX=9606 GN=CABIN1 PE=1 SV=1
7	AFDB:Q9ESU6	0.070	0.043	3.559E-1	1400	0.118	0.061	Q9ESU6.pdb.gz	BRD4_MOUSE Bromodomain-containing protein 4 OS=Mus musculus OX=10090 GN=Brd4 PE=1 SV=2
8	AFDB:D3ZAX5	0.105	0.086	3.718E-1	935	0.136	0.105	D3ZAX5.pdb.gz	D3ZAX5_RAT Calcium homeostasis endoplasmic reticulum protein OS=Rattus norvegicus OX=10116 GN=Cherp PE=1 SV=3
9	AFDB:P17040	0.078	0.061	4.628E-1	1043	0.141	0.097	P17040.pdb.gz	ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens OX=9606 GN=ZSCAN20 PE=1 SV=3
10	AFDB:Q8LL04	0.125	0.078	4.628E-1	1241	0.128	0.074	Q8LL04.pdb.gz	CPL3_ARATH RNA polymerase II C-terminal domain phosphatase-like 3 OS=Arabidopsis thaliana OX=3702 GN=CPL3 PE=1 SV=2
11	PDB:6sgaCp	0.070	0.249	2.497	178	0.024	0.096	6sgaCp.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
12	PDB:7dvqK	0.081	0.201	2.497	188	0.035	0.133	7dvqK.pdb.gz	Structure of the activated human minor spliceosome.
13	PDB:5ok9B	0.094	0.185	2.725	242	0.036	0.107	5ok9B.pdb.gz
14	PDB:6swy8	0.074	0.133	2.725	325	0.049	0.108	6swy8.pdb.gz
15	PDB:7bfpC	0.072	0.149	2.847	298	0.036	0.087	7bfpC.pdb.gz
16	PDB:6ww7B	0.086	0.198	3.247	281	0.031	0.078	6ww7B.pdb.gz	Structural basis for membrane insertion by the human ER membrane protein complex.
17	PDB:3bs5A	0.086	0.566	4.042	86	0.026	0.221	3bs5A.pdb.gz
18	PDB:2dc3A	0.072	0.194	4.412	172	0.028	0.116	2dc3A.pdb.gz	High-resolution structure of human cytoglobin: identification of extra N- and C-termini and a new dimerization mode.
19	PDB:2btpA	0.062	0.143	4.609	248	0.038	0.109	2btpA.pdb.gz	Structural Basis for Protein-Protein Interactions in the 14-3-3 Protein Family.
20	PDB:4nq0A	0.072	0.178	4.609	254	0.011	0.031	4nq0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V2R1	0.0	619	345	0.430	0.896	G3V2R1_HUMAN Sterile alpha motif domain containing 4A OS=Homo sapiens OX=9606 GN=SAMD4A PE=1 SV=1
2	M0QZ22	0.0	795	692	0.614	0.637	M0QZ22_HUMAN Sterile alpha motif domain containing 4B OS=Homo sapiens OX=9606 GN=SAMD4B PE=1 SV=1
3	Q5PRF9	0.0	811	694	0.624	0.646	SMAG2_HUMAN Protein Smaug homolog 2 OS=Homo sapiens OX=9606 GN=SAMD4B PE=1 SV=1
4	Q80XS6	0.0	811	687	0.628	0.656	SMAG2_MOUSE Protein Smaug homolog 2 OS=Mus musculus OX=10090 GN=Samd4b PE=1 SV=1
5	Q8CBY1	0.0	1322	711	0.951	0.961	SMAG1_MOUSE Protein Smaug homolog 1 OS=Mus musculus OX=10090 GN=Samd4a PE=1 SV=2
6	Q9UPU9	0.0	1484	718	1.000	1.000	SMAG1_HUMAN Protein Smaug homolog 1 OS=Homo sapiens OX=9606 GN=SAMD4A PE=1 SV=3
7	M0R0X3	1.45e-131	394	325	0.311	0.686	M0R0X3_HUMAN Sterile alpha motif domain containing 4B OS=Homo sapiens OX=9606 GN=SAMD4B PE=1 SV=1
8	M0QY61	3.33e-88	277	219	0.212	0.694	M0QY61_HUMAN Sterile alpha motif domain containing 4B (Fragment) OS=Homo sapiens OX=9606 GN=SAMD4B PE=1 SV=1
9	Q23972	5.64e-22	103	999	0.074	0.053	SMG_DROME Protein Smaug OS=Drosophila melanogaster OX=7227 GN=smg PE=1 SV=2
10	Q08831	3.45e-05	49.3	523	0.039	0.054	VTS1_YEAST RNA-binding protein VTS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VTS1 PE=1 SV=1
11	Q8WYQ9	3.70e-05	49.7	949	0.042	0.032	ZCH14_HUMAN Zinc finger CCHC domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZCCHC14 PE=1 SV=1
12	Q9P6R7	6.35e-05	48.9	713	0.031	0.031	VTS1_SCHPO RNA-binding protein vts1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC13E7.03c PE=1 SV=1
13	J9VVN9	1.21e-04	47.8	687	0.026	0.028	VTS1_CRYNH RNA-binding protein VTS1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=VTS1 PE=1 SV=1
14	P35207	1.3	35.0	1287	0.043	0.024	SKI2_YEAST Antiviral helicase SKI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKI2 PE=1 SV=2
15	Q8IWN7	2.7	33.9	2400	0.061	0.018	RP1L1_HUMAN Retinitis pigmentosa 1-like 1 protein OS=Homo sapiens OX=9606 GN=RP1L1 PE=1 SV=5
16	F1MB71	5.5	32.7	1361	0.040	0.021	F1MB71_BOVIN CASK interacting protein 1 OS=Bos taurus OX=9913 GN=CASKIN1 PE=4 SV=3
17	A0A0B4KH49	5.8	31.2	128	0.028	0.156	A0A0B4KH49_DROME Shal K[+] channel interacting protein, isoform H OS=Drosophila melanogaster OX=7227 GN=SKIP PE=4 SV=1
18	Q8SZS0	5.8	32.7	952	0.028	0.021	Q8SZS0_DROME LD31046p OS=Drosophila melanogaster OX=7227 GN=SKIP PE=2 SV=1
19	A0A0B4KHV7	6.0	32.7	1080	0.028	0.019	A0A0B4KHV7_DROME Shal K[+] channel interacting protein, isoform I OS=Drosophila melanogaster OX=7227 GN=SKIP PE=4 SV=1
20	Q0KI30	6.7	32.7	1064	0.028	0.019	Q0KI30_DROME Shal K[+] channel interacting protein, isoform E OS=Drosophila melanogaster OX=7227 GN=SKIP PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09246 PHAT	0.15	23.1	PHAT
2	PF00536 SAM_1	2.1e-05	36.2	SAM domain (Sterile alpha motif)
3	PF07647 SAM_2	27	16.3	SAM domain (Sterile alpha motif)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000375919

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401371	0.776	Nucleolysin TIA-1 isoform p40
2	9606.ENSP00000358089	0.775	Nucleolysin TIAR
3	9606.ENSP00000360922	0.769	Double-stranded RNA-binding protein Staufen homolog 1
4	9606.ENSP00000393275	0.757	Nanos homolog 1
5	9606.ENSP00000262160	0.742	Mothers against decapentaplegic homolog 2
6	9606.ENSP00000317224	0.685	Protein Smaug homolog 2
7	9606.ENSP00000385269	0.665	ELAV-like protein 1
8	9606.ENSP00000468032	0.654	Sterile alpha and TIR motif-containing protein 1
9	9606.ENSP00000264335	0.624	14-3-3 protein epsilon
10	9606.ENSP00000335017	0.621	Proline-rich protein 30
11	9606.ENSP00000452634	0.612	Tumor necrosis factor alpha-induced protein 2
12	9606.ENSP00000469591	0.604	Zinc finger protein 628
13	9606.ENSP00000294517	0.596	Antizyme inhibitor 2
14	9606.ENSP00000412886	0.574	Calmodulin-binding transcription activator 2
15	9606.ENSP00000206423	0.568	Coiled-coil domain-containing protein 80
16	9606.ENSP00000267569	0.565	Jun dimerization protein 2
17	9606.ENSP00000281146	0.556	UPF0462 protein C4orf33
18	9606.ENSP00000341021	0.554	Nanos homolog 2
19	9606.ENSP00000216416	0.548	Protein cornichon homolog 1
20	9606.ENSP00000358902	0.547	Sterile alpha motif domain containing 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030371	1.000	translation repressor activity
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048518	0.987	positive regulation of biological process
GO:0006417	0.987	regulation of translation
GO:0051173	0.982	positive regulation of nitrogen compound metabolic process
GO:0031325	0.982	positive regulation of cellular metabolic process
GO:0010604	0.979	positive regulation of macromolecule metabolic process
GO:0045727	0.916	positive regulation of translation
GO:0009987	0.814	cellular process
GO:0051252	0.441	regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.993	cytosol
GO:0005634	0.975	nucleus
GO:0031981	0.954	nuclear lumen
GO:0043232	0.929	intracellular non-membrane-bounded organelle
GO:0030054	0.671	cell junction
GO:0005654	0.492	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]