StarFunc result for job id Q9UPV0

User Input

>input (1460 residues)
MAGRPLRIGDQLVLEEDYDETYIPSEQEILEFAREIGIDPIKEPELMWLAREGIVAPLPG
EWKPCQDITGDIYYFNFANGQSMWDHPCDEHYRSLVIQERAKLSTSGAIKKKKKKKEKKD
KKDRDPPKSSLALGSSLAPVHVPLGGLAPLRGLVDTPPSALRGSQSVSLGSSVESGRQLG
ELMLPSQGLKTSAYTKGLLGSIYEDKTALSLLGLGEETNEEDEEESDNQSVHSSSEPLRN
LHLDIGALGGDFEYEESLRTSQPEEKKDVSLDSDAAGPPTPCKPSSPGADSSLSSAVGKG
RQGSGARPGLPEKEENEKSEPKICRNLVTPKADPTGSEPAKASEKEAPEDTVDAGEEGSR
REEAAKEPKKKASALEEGSSDASQELEISEHMKEPQLSDSIASDPKSFHGLDFGFRSRIS
EHLLDVDVLSPVLGGACRQAQQPLGIEDKDDSQSSQDELQSKQSKGLEERLSPPLPHEER
AQSPPRSLATEEEPPQGPEGQPEWKEAEELGEDSAASLSLQLSLQREQAPSPPAACEKGK
EQHSQAEELGPGQEEAEDPEEKVAVSPTPPVSPEVRSTEPVAPPEQLSEAALKAMEEAVA
QVLEQDQRHLLESKQEKMQQLREKLCQEEEEEILRLHQQKEQSLSSLRERLQKAIEEEEA
RMREEESQRLSWLRAQVQSSTQADEDQIRAEQEASLQKLREELESQQKAERASLEQKNRQ
MLEQLKEEIEASEKSEQAALNAAKEKALQQLREQLEGERKEAVATLEKEHSAELERLCSS
LEAKHREVVSSLQKKIQEAQQKEEAQLQKCLGQVEHRVHQKSYHVAGYEHELSSLLREKR
QEVEGEHERRLDKMKEEHQQVMAKAREQYEAEERKQRAELLGHLTGELERLQRAHERELE
TVRQEQHKRLEDLRRRHREQERKLQDLELDLETRAKDVKARLALLEVQEETARREKQQLL
DVQRQVALKSEEATATHQQLEEAQKEHTHLLQSNQQLREILDELQARKLKLESQVDLLQA
QSQQLQKHFSSLEAEAQKKQHLLREVTVEENNASPHFEPDLHIEDLRKSLGTNQTKEVSS
SLSQSKEDLYLDSLSSHNVWHLLSAEGVALRSAKEFLVQQTRSMRRRQTALKAAQQHWRH
ELASAQEVAKDPPGIKALEDMRKNLEKETRHLDEMKSAMRKGHNLLKKKEEKLNQLESSL
WEEASDEGTLGGSPTKKAVTFDLSDMDSLSSESSESFSPPHREWWRQQRIDSTPSLTSRK
IHGLSHSLRQISSQLSSVLSILDSLNPQSPPPLLASMPAQLPPRDPKSTPTPTYYGSLAR
FSALSSATPTSTQWAWDSGQGPRLPSSVAQTVDDFLLEKWRKYFPSGIPLLSNSPTPLES
RLGYMSASEQLRLLQHSHSQVPEAGSTTFQGIIEANRRWLERVKNDPRLPLFSSTPKPKA
TLSLLQLGLDEHNRVKVYRF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5DU05	0.153	0.154	0.000	1446	0.673	0.680	Q5DU05.pdb.gz	CE164_MOUSE Centrosomal protein of 164 kDa OS=Mus musculus OX=10090 GN=Cep164 PE=1 SV=2
2	AFDB:Q9UPV0	1.000	1.000	0.000	1460	1.000	1.000	Q9UPV0.pdb.gz	CE164_HUMAN Centrosomal protein of 164 kDa OS=Homo sapiens OX=9606 GN=CEP164 PE=1 SV=3
3	AFDB:A0A024R370	0.060	0.078	4.514E-9	1093	0.136	0.182	A0A024R370.pdb.gz
4	AFDB:E7F5E1	0.076	0.080	6.902E-9	1367	0.153	0.163	E7F5E1.pdb.gz	CE162_DANRE Centrosomal protein of 162 kDa OS=Danio rerio OX=7955 GN=cep162 PE=2 SV=1
5	AFDB:Q6ZQ06	0.057	0.057	2.466E-8	1403	0.150	0.156	Q6ZQ06.pdb.gz	CE162_MOUSE Centrosomal protein of 162 kDa OS=Mus musculus OX=10090 GN=Cep162 PE=1 SV=2
6	AFDB:Q5TB80	0.068	0.070	1.057E-7	1403	0.149	0.155	Q5TB80.pdb.gz	CE162_HUMAN Centrosomal protein of 162 kDa OS=Homo sapiens OX=9606 GN=CEP162 PE=1 SV=2
7	AFDB:A2A870	0.102	0.122	1.347E-7	1173	0.136	0.169	A2A870.pdb.gz	FBF1_MOUSE Fas-binding factor 1 OS=Mus musculus OX=10090 GN=Fbf1 PE=1 SV=1
8	AFDB:Q9VQM0	0.082	0.057	3.148E-7	2162	0.162	0.109	Q9VQM0.pdb.gz	Q9VQM0_DROME Toucan, isoform A OS=Drosophila melanogaster OX=7227 GN=toc PE=4 SV=2
9	AFDB:A0A2R8Y7M0	0.094	0.122	3.153E-6	985	0.129	0.191	A0A2R8Y7M0.pdb.gz	A0A2R8Y7M0_HUMAN TATA element modulatory factor 1 OS=Homo sapiens OX=9606 GN=TMF1 PE=1 SV=1
10	AFDB:Q7TME2	0.097	0.118	6.935E-6	1165	0.134	0.167	Q7TME2.pdb.gz	SPAG5_MOUSE Sperm-associated antigen 5 OS=Mus musculus OX=10090 GN=Spag5 PE=1 SV=1
11	PDB:1yw5A	0.024	0.174	1.366E-1	177	0.010	0.079	1yw5A.pdb.gz
12	PDB:4dk0A	0.057	0.247	1.639E-1	324	0.009	0.040	4dk0A.pdb.gz
13	PDB:3k29A	0.055	0.294	3.005E-1	162	0.010	0.086	3k29A.pdb.gz
14	PDB:7vvuV	0.062	0.539	4.594E-1	113	0.012	0.150	7vvuV.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
15	PDB:5nikD	0.059	0.241	5.855E-1	340	0.007	0.029	5nikD.pdb.gz
16	PDB:2b5uA	0.065	0.172	7.024E-1	470	0.016	0.051	2b5uA.pdb.gz
17	PDB:5ng5A	0.045	0.159	1.011	340	0.010	0.041	5ng5A.pdb.gz	An allosteric transport mechanism for the AcrAB-TolC Multidrug Efflux Pump.
18	PDB:5nugA	0.058	0.030	1.141	2920	0.009	0.004	5nugA.pdb.gz	Cryo-EM Reveals How Human Cytoplasmic Dynein Is Auto-inhibited and Activated.
19	PDB:6v4uB	0.052	0.147	1.141	421	0.010	0.033	6v4uB.pdb.gz
20	PDB:7tveD	0.052	0.147	1.141	445	0.012	0.038	7tveD.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5DU05	0.0	1582	1446	0.667	0.674	CE164_MOUSE Centrosomal protein of 164 kDa OS=Mus musculus OX=10090 GN=Cep164 PE=1 SV=2
2	Q9UPV0	0.0	2907	1460	1.000	1.000	CE164_HUMAN Centrosomal protein of 164 kDa OS=Homo sapiens OX=9606 GN=CEP164 PE=1 SV=3
3	Q582C1	1.41e-20	101	1177	0.034	0.042	Q582C1_TRYB2 WW domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.560 PE=4 SV=1
4	Q383B5	1.41e-17	91.7	1006	0.038	0.055	Q383B5_TRYB2 WW domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3520 PE=4 SV=1
5	Q57UV7	1.76e-04	48.9	1456	0.072	0.072	Q57UV7_TRYB2 Kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.4A8.660 PE=3 SV=1
6	O95613	0.009	43.5	3336	0.057	0.025	PCNT_HUMAN Pericentrin OS=Homo sapiens OX=9606 GN=PCNT PE=1 SV=4
7	O55098	0.021	42.0	966	0.068	0.102	STK10_MOUSE Serine/threonine-protein kinase 10 OS=Mus musculus OX=10090 GN=Stk10 PE=1 SV=2
8	Q5JR59	0.023	42.0	1369	0.019	0.020	MTUS2_HUMAN Microtubule-associated tumor suppressor candidate 2 OS=Homo sapiens OX=9606 GN=MTUS2 PE=1 SV=3
9	Q586S4	0.055	40.4	1340	0.034	0.037	Q586S4_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.175 PE=4 SV=1
10	P07942	0.091	40.0	1786	0.043	0.035	LAMB1_HUMAN Laminin subunit beta-1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2
11	Q4QRL3	0.097	39.7	1481	0.082	0.081	CC88B_MOUSE Coiled-coil domain-containing protein 88B OS=Mus musculus OX=10090 GN=Ccdc88b PE=1 SV=2
12	B9EKI3	0.20	38.9	1091	0.088	0.117	TMF1_MOUSE TATA element modulatory factor OS=Mus musculus OX=10090 GN=Tmf1 PE=1 SV=2
13	Q54HI5	0.24	38.5	716	0.046	0.094	LMNB1_DICDI Lamin-like protein OS=Dictyostelium discoideum OX=44689 GN=lmnB PE=1 SV=1
14	Q7FAD5	0.34	38.1	869	0.028	0.047	ZEP1_ORYSJ Synaptonemal complex protein ZEP1 OS=Oryza sativa subsp. japonica OX=39947 GN=ZEP1 PE=1 SV=2
15	Q9H2G2	0.70	37.0	1235	0.067	0.079	SLK_HUMAN STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK PE=1 SV=1
16	O54988	0.82	36.6	1233	0.070	0.083	SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Slk PE=1 SV=2
17	Q5B424	0.91	36.6	2404	0.053	0.032	Q5B424_EMENI Myosin II homolog (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04706 PE=3 SV=1
18	Q92614	0.96	36.6	2054	0.048	0.034	MY18A_HUMAN Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A PE=1 SV=3
19	Q6AW69	1.2	36.2	1297	0.083	0.093	CGNL1_MOUSE Cingulin-like protein 1 OS=Mus musculus OX=10090 GN=Cgnl1 PE=1 SV=3
20	Q2PQA9	1.4	35.8	963	0.075	0.113	KINH_RAT Kinesin-1 heavy chain OS=Rattus norvegicus OX=10116 GN=Kif5b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00397 WW	0.015	26.6	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000278935

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000267890	0.990	Tau-tubulin kinase 2
2	9606.ENSP00000281142	0.990	Sodium channel and clathrin linker 1
3	9606.ENSP00000324292	0.990	Fas-binding factor 1
4	9606.ENSP00000380911	0.988	Centrosomal protein of 83 kDa
5	9606.ENSP00000306105	0.981	Centrosomal protein of 89 kDa
6	9606.ENSP00000447300	0.978	Rab-3A-interacting protein
7	9606.ENSP00000323099	0.956	ATR-interacting protein
8	9606.ENSP00000388648	0.932	Serine/threonine-protein kinase Chk1
9	9606.ENSP00000343741	0.926	Serine/threonine-protein kinase ATR
10	9606.ENSP00000371472	0.920	Ninein
11	9606.ENSP00000312995	0.917	Claspin
12	9606.ENSP00000254719	0.903	Replication protein A 70 kDa DNA-binding subunit
13	9606.ENSP00000260810	0.903	DNA topoisomerase 2-binding protein 1
14	9606.ENSP00000258774	0.901	Checkpoint protein HUS1
15	9606.ENSP00000055077	0.900	Replication factor C subunit 2
16	9606.ENSP00000261881	0.900	TIMELESS-interacting protein
17	9606.ENSP00000311360	0.900	Cell cycle checkpoint control protein RAD9A
18	9606.ENSP00000363017	0.900	Replication protein A 32 kDa subunit
19	9606.ENSP00000369411	0.900	Replication factor C subunit 3
20	9606.ENSP00000371469	0.900	Cell cycle checkpoint protein RAD1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0060271	0.993	cilium assembly
GO:0065007	0.641	biological regulation
GO:0050789	0.632	regulation of biological process
GO:0050794	0.588	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005814	1.000	centriole
GO:0005829	0.999	cytosol
GO:0097539	0.999	ciliary transition fiber
GO:0005654	0.999	nucleoplasm
GO:0005813	0.992	centrosome
GO:0005576	0.939	extracellular region
GO:0005615	0.901	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]