StarFunc result for job id Q9UPV7

User Input

>input (400 residues)
MGVLMSKRQTVEQVQKVSLAVSAFKDGLRDRPSIRRTGELPGSRRGTVEGSVQEVQEEKE
AEAGTSVVQEESSAGRAAWERLRDGRGVEPEEFDRTSRFTPPAFIRPTRKLDDDKPPEIC
LEPREPVVNDEMCDVCEVWTAESLFPCRVCTRVFHDGCLRRMGYIQGDSAAEVTEMAHTE
TGWSCHYCDNINLLLTEEEMYSLTETFQRCKVIPDCSLTLEDFLRYRHQAAKRGDRDRAL
SEEQEEQAARQFAALDPEHRGHIEWPDFLSHESLLLLQQLRPQNSLLRLLTVKERERARA
AFLARGSGSTVSEAECRRAQHSWFCKRFPEAPSCSVSISHVGPIADSSPASSSSKSQDKT
LLPTEQESRFVDWPTFLQENVLYILAARPNSAAIHLKPPG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q80TL4	0.811	0.811	2.900E-56	400	0.910	0.910	Q80TL4.pdb.gz	PHF24_MOUSE PHD finger protein 24 OS=Mus musculus OX=10090 GN=Phf24 PE=1 SV=2
2	PDB:1v1fA	0.147	0.268	8.837E-3	188	0.068	0.144	1v1fA.pdb.gz	The Structure of the Arabidopsis Thaliana SOS3: Molecular Mechanism of Sensing Calcium for Salt Stress Response
3	PDB:5aanA	0.154	0.296	1.091E-2	183	0.062	0.137	5aanA.pdb.gz	Interference of the complex between NCS-1 and Ric8a with phenothiazines regulates synaptic function and is an approach for fragile X syndrome.
4	AFDB:Q9U3Y7	0.115	0.059	1.919E-2	1133	0.133	0.047	Q9U3Y7.pdb.gz	Q9U3Y7_DROME Bonus OS=Drosophila melanogaster OX=7227 GN=bon PE=2 SV=1
5	PDB:1osaA	0.149	0.321	3.668E-2	148	0.070	0.189	1osaA.pdb.gz	Structure of the recombinant Paramecium tetraurelia calmodulin at 1.68 A resolution.
6	PDB:5d43A	0.158	0.352	4.774E-2	150	0.043	0.113	5d43A.pdb.gz	Crystal Structure of Wild-Type Centrin 1 from Mus musculus Occupied by Ca2.
7	PDB:6tz8B	0.143	0.283	8.088E-2	174	0.043	0.098	6tz8B.pdb.gz	Harnessing calcineurin-FK506-FKBP12 crystal structures from invasive fungal pathogens to develop antifungal agents.
8	PDB:2julA	0.142	0.281	9.473E-2	181	0.065	0.144	2julA.pdb.gz	NMR structure of DREAM: Implications for Ca(2+)-dependent DNA binding and protein dimerization.
9	PDB:2zfdA	0.147	0.280	9.473E-2	183	0.055	0.120	2zfdA.pdb.gz	The crystal structure of plant-specific calcium-binding protein AtCBL2 in complex with the regulatory domain of AtCIPK14
10	PDB:7eebI	0.193	0.372	9.473E-2	174	0.068	0.155	7eebI.pdb.gz	Structure of a mammalian sperm cation channel complex.
11	PDB:1omrA	0.128	0.222	1.110E-1	201	0.050	0.100	1omrA.pdb.gz	Impact of N-terminal myristoylation on the Ca2+-dependent conformational transition in recoverin
12	PDB:2f2pA	0.149	0.290	1.522E-1	169	0.058	0.136	2f2pA.pdb.gz	Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.
13	AFDB:D5LMF5	0.090	0.043	2.823E-1	1165	0.105	0.036	D5LMF5.pdb.gz	D5LMF5_XENLA Protein kinase C-binding protein 1 OS=Xenopus laevis OX=8355 GN=zmynd8.S PE=2 SV=1
14	AFDB:A0A087WVZ6	0.095	0.043	8.101E-1	1136	0.105	0.037	A0A087WVZ6.pdb.gz	A0A087WVZ6_HUMAN Zinc finger MYND-type containing 8 OS=Homo sapiens OX=9606 GN=ZMYND8 PE=1 SV=2
15	AFDB:Q9VDY9	0.109	0.105	8.540E-1	418	0.102	0.098	Q9VDY9.pdb.gz	Q9VDY9_DROME GH10101p OS=Drosophila melanogaster OX=7227 GN=myd PE=2 SV=2
16	AFDB:A0A2R8QB31	0.117	0.065	1.302	797	0.140	0.070	A0A2R8QB31.pdb.gz	A0A2R8QB31_DANRE PHD finger protein 21A isoform X7 OS=Danio rerio OX=7955 GN=phf21ab PE=1 SV=1
17	AFDB:A0A2R8RUQ1	0.114	0.064	1.447	828	0.133	0.064	A0A2R8RUQ1.pdb.gz
18	AFDB:Q05DH4	0.097	0.051	2.451	1040	0.117	0.045	Q05DH4.pdb.gz	FHI1A_HUMAN FHF complex subunit HOOK-interacting protein 1A OS=Homo sapiens OX=9606 GN=FHIP1A PE=1 SV=2
19	AFDB:Q9BX63	0.083	0.039	2.583	1249	0.113	0.036	Q9BX63.pdb.gz	FANCJ_HUMAN Fanconi anemia group J protein OS=Homo sapiens OX=9606 GN=BRIP1 PE=1 SV=2
20	AFDB:P40038	0.077	0.074	2.723	420	0.130	0.124	P40038.pdb.gz	PCL6_YEAST PHO85 cyclin-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PCL6 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80TL4	0.0	720	400	0.910	0.910	PHF24_MOUSE PHD finger protein 24 OS=Mus musculus OX=10090 GN=Phf24 PE=1 SV=2
2	Q9UPV7	0.0	820	400	1.000	1.000	PHF24_HUMAN PHD finger protein 24 OS=Homo sapiens OX=9606 GN=PHF24 PE=1 SV=2
3	Q9SY59	1.4	33.9	1188	0.052	0.018	NFXL1_ARATH NF-X1-type zinc finger protein NFXL1 OS=Arabidopsis thaliana OX=3702 GN=NFXL1 PE=1 SV=1
4	Q18916	2.3	33.1	655	0.065	0.040	Q18916_CAEEL Fatty Acid CoA Synthetase family OS=Caenorhabditis elegans OX=6239 GN=acs-22 PE=1 SV=1
5	Q94C26	2.9	30.0	81	0.048	0.235	PCC1_ARATH Cysteine-rich and transmembrane domain-containing protein PCC1 OS=Arabidopsis thaliana OX=3702 GN=PCC1 PE=1 SV=1
6	Q388M7	3.2	32.3	377	0.065	0.069	Q388M7_TRYB2 RNA-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.3200 PE=4 SV=1
7	Q6PCT2	3.3	32.3	694	0.040	0.023	FXL19_HUMAN F-box/LRR-repeat protein 19 OS=Homo sapiens OX=9606 GN=FBXL19 PE=1 SV=3
8	A0A8I5ZZH4	3.5	32.3	1210	0.048	0.016	A0A8I5ZZH4_RAT Zinc finger, MYND-type containing 8 OS=Rattus norvegicus OX=10116 GN=Zmynd8 PE=1 SV=1
9	A0A8I5XZV4	3.6	32.3	1256	0.048	0.015	A0A8I5XZV4_RAT Zinc finger, MYND-type containing 8 OS=Rattus norvegicus OX=10116 GN=Zmynd8 PE=1 SV=1
10	A8C4G9	3.6	32.3	1208	0.048	0.016	A8C4G9_RAT Spikar OS=Rattus norvegicus OX=10116 GN=Zmynd8 PE=1 SV=1
11	A0A8I5ZX36	3.7	32.3	1212	0.048	0.016	A0A8I5ZX36_RAT Zinc finger, MYND-type containing 8 OS=Rattus norvegicus OX=10116 GN=Zmynd8 PE=1 SV=1
12	A0A8I6A294	3.7	32.3	1232	0.048	0.015	A0A8I6A294_RAT Zinc finger, MYND-type containing 8 OS=Rattus norvegicus OX=10116 GN=Zmynd8 PE=1 SV=1
13	A0A0G2K9F7	3.8	32.3	1176	0.048	0.016	A0A0G2K9F7_RAT Zinc finger, MYND-type containing 8 OS=Rattus norvegicus OX=10116 GN=Zmynd8 PE=1 SV=2
14	Q9FMP5	3.8	32.3	528	0.060	0.045	CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana OX=3702 GN=CPK17 PE=2 SV=1
15	A0A087WVZ6	4.8	32.0	1136	0.048	0.017	A0A087WVZ6_HUMAN Zinc finger MYND-type containing 8 OS=Homo sapiens OX=9606 GN=ZMYND8 PE=1 SV=2
16	Q9ULU4	5.1	32.0	1186	0.048	0.016	ZMYD8_HUMAN MYND-type zinc finger-containing chromatin reader ZMYND8 OS=Homo sapiens OX=9606 GN=ZMYND8 PE=1 SV=2
17	Q3E9C0	5.3	31.6	523	0.060	0.046	CDPKY_ARATH Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana OX=3702 GN=CPK34 PE=2 SV=1
18	H7C4X9	5.4	32.0	1095	0.048	0.017	H7C4X9_HUMAN Zinc finger MYND-type containing 8 (Fragment) OS=Homo sapiens OX=9606 GN=ZMYND8 PE=1 SV=2
19	A0A087WV57	5.8	31.6	767	0.048	0.025	A0A087WV57_HUMAN Zinc finger MYND-type containing 8 OS=Homo sapiens OX=9606 GN=ZMYND8 PE=1 SV=1
20	P03261	6.2	31.6	1198	0.087	0.029	DPOL_ADE02 DNA polymerase OS=Human adenovirus C serotype 2 OX=10515 GN=POL PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	71	14.7	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF13499 EF-hand_7	61	15.5	EF-hand domain pair
3	PF00628 PHD	2.1e+02	13.2	PHD-finger
4	PF16744 zf-RING_15	1.7e-33	125.9	KIAA1045 RING finger
5	PF17120 zf-RING_16	0.38	21.7	RING/Ubox like zinc-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000242315

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000318912	0.707	Carbonic anhydrase 13
2	9606.ENSP00000462046	0.638	Phosphoinositide-interacting protein
3	9606.ENSP00000314407	0.613	Carbonic anhydrase-related protein
4	9606.ENSP00000295569	0.552	Protein FAM19A4
5	9606.ENSP00000265018	0.525	Protein FAM184B
6	9606.ENSP00000420927	0.513	[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial
7	9606.ENSP00000450607	0.508	Protein timeless homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.993	response to stimulus
GO:0050794	0.993	regulation of cellular process
GO:0023052	0.988	signaling
GO:0007154	0.988	cell communication
GO:0009582	0.968	detection of abiotic stimulus
GO:0032501	0.960	multicellular organismal process
GO:0023051	0.953	regulation of signaling
GO:0010646	0.953	regulation of cell communication
GO:0048583	0.909	regulation of response to stimulus
GO:0007267	0.906	cell-cell signaling
GO:0019233	0.902	sensory perception of pain
GO:0050906	0.901	detection of stimulus involved in sensory perception
GO:0009581	0.897	detection of external stimulus
GO:0099177	0.876	regulation of trans-synaptic signaling
GO:0050804	0.873	modulation of chemical synaptic transmission
GO:0009966	0.844	regulation of signal transduction
GO:0008277	0.810	regulation of G protein-coupled receptor signaling pathway
GO:0009612	0.795	response to mechanical stimulus
GO:0062149	0.760	detection of stimulus involved in sensory perception of pain
GO:0050974	0.760	detection of mechanical stimulus involved in sensory perception
GO:0032228	0.607	regulation of synaptic transmission, GABAergic
GO:0051716	0.513	cellular response to stimulus
GO:0007214	0.441	gamma-aminobutyric acid signaling pathway
GO:0007165	0.387	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005737	0.999	cytoplasm
GO:0043229	0.995	intracellular organelle
GO:0016020	0.915	membrane
GO:0043231	0.894	intracellular membrane-bounded organelle
GO:0071944	0.375	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]