StarFunc result for job id Q9UPV9

User Input

>input (953 residues)
MALVFQFGQPVRAQPLPGLCHGKLIRTNACDVCNSTDLPEVEIISLLEEQLPHYKLRADT
IYGYDHDDWLHTPLISPDANIDLTTEQIEETLKYFLLCAERVGQMTKTYNDIDAVTRLLE
EKERDLELAARIGQSLLKKNKTLTERNELLEEQVEHIREEVSQLRHELSMKDELLQFYTS
AAEESEPESVCSTPLKRNESSSSVQNYFHLDSLQKKLKDLEEENVVLRSEASQLKTETIT
YEEKEQQLVNDCVKELRDANVQIASISEELAKKTEDAARQQEEITHLLSQIVDLQKKAKA
CAVENEELVQHLGAAKDAQRQLTAELRELEDKYAECMEMLHEAQEELKNLRNKTMPNTTS
RRYHSLGLFPMDSLAAEIEGTMRKELQLEEAESPDITHQKRVFETVRNINQVVKQRSLTP
SPMNIPGSNQSSAMNSLLSSCVSTPRSSFYGSDIGNVVLDNKTNSIILETEAADLGNDER
SKKPGTPGTPGSHDLETALRRLSLRRENYLSERRFFEEEQERKLQELAEKGELRSGSLTP
TESIMSLGTHSRFSEFTGFSGMSFSSRSYLPEKLQIVKPLEGSATLHHWQQLAQPHLGGI
LDPRPGVVTKGFRTLDVDLDEVYCLNDFEEDDTGDHISLPRLATSTPVQHPETSAHHPGK
CMSQTNSTFTFTTCRILHPSDELTRVTPSLNSAPTPACGSTSHLKSTPVATPCTPRRLSL
AESFTNTRESTTTMSTSLGLVWLLKERGISAAVYDPQSWDRAGRGSLLHSYTPKMAVIPS
TPPNSPMQTPTSSPPSFEFKCTSPPYDNFLASKPASSILREVREKNVRSSESQTDVSVSN
LNLVDKVRRFGVAKVVNSGRAHVPTLTEEQGPLLCGPPGPAPALVPRGLVPEGLPLRCPT
VTSAIGGLQLNSGIRRNRSFPTMVGSSMQMKAPVTLTSGILMGAKLSKQTSLR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UPV9	1.000	1.000	0.000	953	1.000	1.000	Q9UPV9.pdb.gz	TRAK1_HUMAN Trafficking kinesin-binding protein 1 OS=Homo sapiens OX=9606 GN=TRAK1 PE=1 SV=1
2	AFDB:O60296	0.204	0.212	7.360E-59	914	0.475	0.496	O60296.pdb.gz	TRAK2_HUMAN Trafficking kinesin-binding protein 2 OS=Homo sapiens OX=9606 GN=TRAK2 PE=1 SV=2
3	AFDB:Q6P9N8	0.205	0.213	7.874E-59	913	0.476	0.497	Q6P9N8.pdb.gz	Q6P9N8_MOUSE Trafficking protein, kinesin binding 2 OS=Mus musculus OX=10090 GN=Trak2 PE=1 SV=1
4	AFDB:E7ESP9	0.101	0.110	1.012E-7	877	0.124	0.135	E7ESP9.pdb.gz	E7ESP9_HUMAN Neurofilament medium chain OS=Homo sapiens OX=9606 GN=NEFM PE=1 SV=1
5	AFDB:P07197	0.102	0.105	1.083E-7	916	0.130	0.135	P07197.pdb.gz	NFM_HUMAN Neurofilament medium polypeptide OS=Homo sapiens OX=9606 GN=NEFM PE=1 SV=3
6	AFDB:P34216	0.145	0.102	1.988E-7	1381	0.142	0.098	P34216.pdb.gz	EDE1_YEAST EH domain-containing and endocytosis protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EDE1 PE=1 SV=2
7	AFDB:P19246	0.112	0.099	7.177E-7	1090	0.157	0.138	P19246.pdb.gz	NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus OX=10090 GN=Nefh PE=1 SV=3
8	AFDB:P12036	0.136	0.127	8.789E-7	1026	0.140	0.130	P12036.pdb.gz	NFH_HUMAN Neurofilament heavy polypeptide OS=Homo sapiens OX=9606 GN=NEFH PE=1 SV=4
9	AFDB:P16884	0.111	0.100	3.632E-6	1072	0.139	0.123	P16884.pdb.gz	NFH_RAT Neurofilament heavy polypeptide OS=Rattus norvegicus OX=10116 GN=Nefh PE=1 SV=4
10	AFDB:E9PVD1	0.137	0.182	7.635E-6	701	0.115	0.157	E9PVD1.pdb.gz	CCD62_MOUSE Coiled-coil domain-containing protein 62 OS=Mus musculus OX=10090 GN=Ccdc62 PE=1 SV=1
11	PDB:7mqaNA	0.038	0.117	3.854E-1	295	0.033	0.105	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:7d4iBE	0.032	0.034	1.950	890	0.013	0.013	7d4iBE.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
13	PDB:7r5jV0	0.054	0.180	4.100	273	0.047	0.165	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
14	PDB:6ff4C	0.040	0.119	6.148	286	0.039	0.129	6ff4C.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
15	PDB:7dvqR	0.043	0.136	6.578	241	0.039	0.154	7dvqR.pdb.gz	Structure of the activated human minor spliceosome.
16	PDB:5xteA	0.032	0.283	9.866	81	0.013	0.148	5xteA.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
17	PDB:6bk8E	0.033	0.133	9.866	186	0.025	0.129	6bk8E.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
18	PDB:6w19Q	0.032	0.295	9.866	77	0.014	0.169	6w19Q.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5Y2D1	0.0	1144	606	0.592	0.931	A0A8I5Y2D1_RAT Trafficking kinesin protein 1 OS=Rattus norvegicus OX=10116 GN=Trak1 PE=3 SV=1
2	A0A8I5ZSR6	0.0	1779	939	0.933	0.947	A0A8I5ZSR6_RAT Trafficking kinesin protein 1 OS=Rattus norvegicus OX=10116 GN=Trak1 PE=3 SV=1
3	A0A8I6A6Q8	0.0	1086	733	0.565	0.734	A0A8I6A6Q8_RAT Trafficking kinesin protein 1 OS=Rattus norvegicus OX=10116 GN=Trak1 PE=3 SV=1
4	A0A8I6AI05	0.0	1743	968	0.915	0.901	A0A8I6AI05_RAT Trafficking kinesin protein 1 OS=Rattus norvegicus OX=10116 GN=Trak1 PE=3 SV=1
5	D4ACC5	0.0	1071	560	0.556	0.946	D4ACC5_RAT Trafficking kinesin protein 1 OS=Rattus norvegicus OX=10116 GN=Trak1 PE=1 SV=2
6	O60296	0.0	672	914	0.475	0.496	TRAK2_HUMAN Trafficking kinesin-binding protein 2 OS=Homo sapiens OX=9606 GN=TRAK2 PE=1 SV=2
7	Q6P9N8	0.0	707	913	0.484	0.505	Q6P9N8_MOUSE Trafficking protein, kinesin binding 2 OS=Mus musculus OX=10090 GN=Trak2 PE=1 SV=1
8	Q6PD31	0.0	1785	939	0.935	0.949	TRAK1_MOUSE Trafficking kinesin-binding protein 1 OS=Mus musculus OX=10090 GN=Trak1 PE=1 SV=1
9	Q8R2H7	0.0	637	913	0.470	0.491	TRAK2_RAT Trafficking kinesin-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Trak2 PE=1 SV=2
10	Q9UPV9	0.0	1962	953	1.000	1.000	TRAK1_HUMAN Trafficking kinesin-binding protein 1 OS=Homo sapiens OX=9606 GN=TRAK1 PE=1 SV=1
11	Q960V3	1.34e-78	280	1122	0.270	0.229	MILT_DROME Trafficking kinesin-binding protein milt OS=Drosophila melanogaster OX=7227 GN=milt PE=1 SV=1
12	P54257	2.99e-35	145	671	0.113	0.161	HAP1_HUMAN Huntingtin-associated protein 1 OS=Homo sapiens OX=9606 GN=HAP1 PE=1 SV=3
13	P54256	6.11e-31	132	629	0.109	0.165	HAP1_RAT Huntingtin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Hap1 PE=1 SV=1
14	O35668	1.38e-28	124	628	0.103	0.156	HAP1_MOUSE Huntingtin-associated protein 1 OS=Mus musculus OX=10090 GN=Hap1 PE=1 SV=1
15	Q383R7	0.002	44.7	865	0.089	0.098	Q383R7_TRYB2 Trichohyalin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1880 PE=4 SV=1
16	Q7Z7B0	0.010	42.4	1213	0.058	0.045	FLIP1_HUMAN Filamin-A-interacting protein 1 OS=Homo sapiens OX=9606 GN=FILIP1 PE=1 SV=1
17	A0A075B6G6	0.013	42.0	1114	0.058	0.049	A0A075B6G6_HUMAN Filamin A interacting protein 1 OS=Homo sapiens OX=9606 GN=FILIP1 PE=1 SV=1
18	Q9CS72	0.016	41.6	1214	0.058	0.045	FLIP1_MOUSE Filamin-A-interacting protein 1 OS=Mus musculus OX=10090 GN=Filip1 PE=1 SV=3
19	Q3V6T2	0.059	39.7	1871	0.047	0.024	GRDN_HUMAN Girdin OS=Homo sapiens OX=9606 GN=CCDC88A PE=1 SV=2
20	Q8K4T4	0.061	39.7	1212	0.057	0.045	FLIP1_RAT Filamin-A-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Filip1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04849 HAP1_N	1e-130	447.1	HAP1 N-terminal conserved region
2	PF14662 KASH_CCD	4.6	18.6	Coiled-coil region of CCDC155 or KASH
3	PF12448 Milton	9.1e-65	229.5	Kinesin associated protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000328998

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351132	0.995	Mitochondrial Rho GTPase 1
2	9606.ENSP00000362824	0.977	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
3	9606.ENSP00000321971	0.975	Mitochondrial Rho GTPase 2
4	9606.ENSP00000355593	0.954	Disrupted in schizophrenia 1 protein
5	9606.ENSP00000393379	0.934	Kinesin heavy chain isoform 5C
6	9606.ENSP00000379098	0.905	Calcium/calmodulin-dependent protein kinase type II subunit beta
7	9606.ENSP00000319060	0.902	Calcium/calmodulin-dependent protein kinase type II subunit gamma
8	9606.ENSP00000339740	0.902	Calcium/calmodulin-dependent protein kinase type II subunit delta
9	9606.ENSP00000371067	0.902	Tyrosine-protein kinase JAK2
10	9606.ENSP00000381412	0.902	Calcium/calmodulin-dependent protein kinase type II subunit alpha
11	9606.ENSP00000251849	0.900	RAF proto-oncogene serine/threonine-protein kinase
12	9606.ENSP00000290277	0.900	Serine/threonine-protein kinase A-Raf
13	9606.ENSP00000307078	0.897	Kinesin-1 heavy chain
14	9606.ENSP00000408979	0.846	Kinesin heavy chain isoform 5A
15	9606.ENSP00000331201	0.786	Hepatocyte growth factor-regulated tyrosine kinase substrate
16	9606.ENSP00000364204	0.773	Serine/threonine-protein kinase PINK1, mitochondrial
17	9606.ENSP00000371297	0.720	Syntaphilin
18	9606.ENSP00000328875	0.712	Trafficking kinesin-binding protein 2
19	9606.ENSP00000379643	0.704	Nuclear distribution protein nudE homolog 1
20	9606.ENSP00000420617	0.697	Mitofusin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019904	0.958	protein domain specific binding
GO:0030911	0.514	TPR domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0008088	0.990	axo-dendritic transport
GO:0047497	0.990	mitochondrion transport along microtubule
GO:0098930	0.982	axonal transport
GO:0050794	0.975	regulation of cellular process
GO:0048856	0.958	anatomical structure development
GO:0016043	0.957	cellular component organization
GO:0032501	0.954	multicellular organismal process
GO:0048518	0.950	positive regulation of biological process
GO:0051128	0.946	regulation of cellular component organization
GO:0048522	0.939	positive regulation of cellular process
GO:0051130	0.919	positive regulation of cellular component organization
GO:0007275	0.894	multicellular organism development
GO:0051239	0.887	regulation of multicellular organismal process
GO:0031346	0.860	positive regulation of cell projection organization
GO:0022603	0.856	regulation of anatomical structure morphogenesis
GO:0048869	0.855	cellular developmental process
GO:0030154	0.853	cell differentiation
GO:0048731	0.853	system development
GO:0120035	0.841	regulation of plasma membrane bounded cell projection organization
GO:0016358	0.827	dendrite development
GO:0050769	0.819	positive regulation of neurogenesis
GO:0032990	0.810	cell part morphogenesis
GO:0050772	0.801	positive regulation of axonogenesis
GO:0048813	0.795	dendrite morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0042995	0.981	cell projection
GO:0043231	0.977	intracellular membrane-bounded organelle
GO:0120025	0.966	plasma membrane bounded cell projection
GO:0005829	0.964	cytosol
GO:0043005	0.960	neuron projection
GO:0048471	0.959	perinuclear region of cytoplasm
GO:0012505	0.956	endomembrane system
GO:0030425	0.953	dendrite
GO:0044295	0.943	axonal growth cone
GO:0016020	0.894	membrane
GO:0031410	0.867	cytoplasmic vesicle
GO:0005739	0.512	mitochondrion
GO:0071944	0.411	cell periphery
GO:0005886	0.396	plasma membrane
GO:0005654	0.384	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]