StarFunc result for job id Q9UPW5

User Input

>input (1226 residues)
MSKLKVIPEKSLTNNSRIVGLLAQLEKINAEPSESDTARYVTSKILHLAQSQEKTRREMT
AKGSTGMEILLSTLENTKDLQTTLNILSILVELVSAGGGRRVSFLVTKGGSQILLQLLMN
ASKESPPHEDLMVQIHSILAKIGPKDKKFGVKARINGALNITLNLVKQNLQNHRLVLPCL
QLLRVYSANSVNSVSLGKNGVVELMFKIIGPFSKKNSSLIKVALDTLAALLKSKTNARRA
VDRGYVQVLLTIYVDWHRHDNRHRNMLIRKGILQSLKSVTNIKLGRKAFIDANGMKILYN
TSQECLAVRTLDPLVNTSSLIMRKCFPKNRLPLPTIKSSFHFQLPVIPVTGPVAQLYSLP
PEVDDVVDESDDNDDIDVEAENETENEDDLDQNFKNDDIETDINKLKPQQEPGRTIEDLK
MYEHLFPELVDDFQDYDLISKEPKPFVFEGKVRGPIVVPTAGEETSGNSGNLRKVVMKEN
ISSKGDEGEKKSTFMDLAKEDIKDNDRTLQQQPGDQNRTISSVHGLNNDIVKALDRITLQ
NIPSQTAPGFTAEMKKDCSLPLTVLTCAKACPHMATCGNVLFEGRTVQLGKLCCTGVETE
DDEDTESNSSVEQASVEVPDGPTLHDPDLYIEIVKNTKSVPEYSEVAYPDYFGHIPPPFK
EPILERPYGVQRTKIAQDIERLIHQSDIIDRVVYDLDNPNYTIPEEGDILKFNSKFESGN
LRKVIQIRKNEYDLILNSDINSNHYHQWFYFEVSGMRPGVAYRFNIINCEKSNSQFNYGM
QPLMYSVQEALNARPWWIRMGTDICYYKNHFSRSSVAAGGQKGKSYYTITFTVNFPHKDD
VCYFAYHYPYTYSTLQMHLQKLESAHNPQQIYFRKDVLCETLSGNSCPLVTITAMPESNY
YEHICHFRNRPYVFLSARVHPGETNASWVMKGTLEYLMSNNPTAQSLRESYIFKIVPMLN
PDGVINGNHRCSLSGEDLNRQWQSPSPDLHPTIYHAKGLLQYLAAVKRLPLVYCDYHGHS
RKKNVFMYGCSIKETVWHTNDNATSCDVVEDTGYRTLPKILSHIAPAFCMSSCSFVVEKS
KESTARVVVWREIGVQRSYTMESTLCGCDQGKYKGLQIGTRELEEMGAKFCVGLLRLKRL
TSPLEYNLPSSLLDFENDLIESSCKVTSPTTYVLDEDEPRFLEEVDYSAESNDELDIELA
ENVGDYEPSAQEEVLSDSELSRTYLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R288	0.743	0.767	0.000	1186	0.967	1.000	A0A024R288.pdb.gz
2	AFDB:J3KNS1	0.850	0.816	0.000	1278	0.991	0.951	J3KNS1.pdb.gz	J3KNS1_HUMAN tubulin-glutamate carboxypeptidase OS=Homo sapiens OX=9606 GN=AGTPBP1 PE=1 SV=1
3	AFDB:Q4U2V3	0.794	0.843	0.000	1153	0.622	0.662	Q4U2V3.pdb.gz	CBPC1_DANRE Cytosolic carboxypeptidase 1 OS=Danio rerio OX=7955 GN=agtpbp1 PE=2 SV=1
4	AFDB:Q09M05	0.712	0.776	1.446E-85	1122	0.415	0.454	Q09M05.pdb.gz	CBPC4_MOUSE Cytosolic carboxypeptidase 4 OS=Mus musculus OX=10090 GN=Agbl1 PE=1 SV=3
5	AFDB:Q09M02	0.295	0.405	1.660E-20	886	0.117	0.161	Q09M02.pdb.gz	CBPC5_MOUSE Cytosolic carboxypeptidase-like protein 5 OS=Mus musculus OX=10090 GN=Agbl5 PE=1 SV=2
6	AFDB:Q640N1	0.174	0.186	3.026E-7	1128	0.087	0.095	Q640N1.pdb.gz	AEBP1_MOUSE Adipocyte enhancer-binding protein 1 OS=Mus musculus OX=10090 GN=Aebp1 PE=1 SV=1
7	PDB:1kwmA	0.166	0.425	4.620E-7	402	0.052	0.159	1kwmA.pdb.gz	Human procarboxypeptidase B: three-dimensional structure and implications for thrombin-activatable fibrinolysis inhibitor (TAFI).
8	PDB:1ayeA	0.158	0.423	5.014E-7	401	0.038	0.115	1ayeA.pdb.gz	The three-dimensional structure of human procarboxypeptidase A2. Deciphering the basis of the inhibition, activation and intrinsic activity of the zymogen.
9	PDB:4p10A	0.179	0.476	8.893E-7	402	0.047	0.144	4p10A.pdb.gz	Design and synthesis of conformationally restricted inhibitors of active thrombin activatable fibrinolysis inhibitor (TAFIa).
10	PDB:5mrvA	0.165	0.546	1.712E-6	307	0.042	0.166	5mrvA.pdb.gz	Crystal structure and mechanism of human carboxypeptidase O: Insights into its specific activity for acidic residues.
11	PDB:1h8lA	0.171	0.479	2.914E-6	380	0.035	0.113	1h8lA.pdb.gz	The crystal structure of the inhibitor-complexed carboxypeptidase D domain II and the modeling of regulatory carboxypeptidases.
12	PDB:2z6gA	0.176	0.354	2.914E-6	550	0.038	0.084	2z6gA.pdb.gz
13	PDB:2nsmA	0.164	0.457	1.915E-5	390	0.031	0.097	2nsmA.pdb.gz
14	AFDB:Q961B0	0.212	0.242	2.415E-5	1067	0.081	0.093	Q961B0.pdb.gz	Q961B0_DROME LD24920p OS=Drosophila melanogaster OX=7227 GN=Apc2 PE=2 SV=1
15	PDB:5hvfA	0.159	0.432	2.768E-5	372	0.044	0.145	5hvfA.pdb.gz	Elucidation of the molecular mechanisms of two nanobodies that inhibit thrombin-activatable fibrinolysis inhibitor activation and activated thrombin-activatable fibrinolysis inhibitor activity.
16	PDB:4r0zA	0.212	0.446	3.261E-5	557	0.036	0.079	4r0zA.pdb.gz
17	PDB:7rroH7	0.193	0.381	3.687E-5	580	0.040	0.084	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
18	AFDB:Q5H9R7	0.161	0.213	9.322E-5	873	0.065	0.092	Q5H9R7.pdb.gz	PP6R3_HUMAN Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3 PE=1 SV=2
19	AFDB:F4I6B2	0.171	0.241	1.636E-3	811	0.071	0.107	F4I6B2.pdb.gz	F4I6B2_ARATH SIT4 phosphatase-associated family protein OS=Arabidopsis thaliana OX=3702 GN=At1g30470 PE=1 SV=1
20	AFDB:Q96UP3	0.120	0.110	3.023E-3	1400	0.073	0.064	Q96UP3.pdb.gz	RIF1_SCHPO Telomere length regulator protein rif1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rif1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	J3KNS1	0.0	2535	1278	0.991	0.951	J3KNS1_HUMAN tubulin-glutamate carboxypeptidase OS=Homo sapiens OX=9606 GN=AGTPBP1 PE=1 SV=1
2	Q09M05	0.0	748	1122	0.285	0.312	CBPC4_MOUSE Cytosolic carboxypeptidase 4 OS=Mus musculus OX=10090 GN=Agbl1 PE=1 SV=3
3	Q4U2V3	0.0	600	1153	0.245	0.260	CBPC1_DANRE Cytosolic carboxypeptidase 1 OS=Danio rerio OX=7955 GN=agtpbp1 PE=2 SV=1
4	Q641K1	0.0	2269	1218	0.905	0.911	CBPC1_MOUSE Cytosolic carboxypeptidase 1 OS=Mus musculus OX=10090 GN=Agtpbp1 PE=1 SV=2
5	Q9UPW5	0.0	2553	1226	1.000	1.000	CBPC1_HUMAN Cytosolic carboxypeptidase 1 OS=Homo sapiens OX=9606 GN=AGTPBP1 PE=1 SV=3
6	O76373	8.23e-113	379	1015	0.166	0.201	CBPC1_CAEEL Cytosolic carboxypeptidase 1 OS=Caenorhabditis elegans OX=6239 GN=ccpp-1 PE=1 SV=2
7	Q8NEM8	5.29e-108	365	1001	0.153	0.188	CBPC3_HUMAN Cytosolic carboxypeptidase 3 OS=Homo sapiens OX=9606 GN=AGBL3 PE=2 SV=2
8	Q8CDP0	1.44e-104	356	1006	0.150	0.183	CBPC3_MOUSE Cytosolic carboxypeptidase 3 OS=Mus musculus OX=10090 GN=Agbl3 PE=1 SV=1
9	Q5U5Z8	6.45e-99	338	902	0.152	0.206	CBPC2_HUMAN Cytosolic carboxypeptidase 2 OS=Homo sapiens OX=9606 GN=AGBL2 PE=1 SV=2
10	Q8CDK2	7.75e-99	337	862	0.153	0.217	CBPC2_MOUSE Cytosolic carboxypeptidase 2 OS=Mus musculus OX=10090 GN=Agbl2 PE=1 SV=1
11	Q9VY99	1.79e-97	340	1201	0.148	0.152	NNAD_DROME Cytosolic carboxypeptidase Nna1 OS=Drosophila melanogaster OX=7227 GN=Nna1 PE=2 SV=2
12	Q389Q3	4.46e-80	291	1570	0.144	0.112	Q389Q3_TRYB2 Zinc carboxypeptidase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.406.0130 PE=3 SV=1
13	Q09296	7.72e-65	229	459	0.131	0.351	CBPC6_CAEEL Cytosolic carboxypeptidase 6 OS=Caenorhabditis elegans OX=6239 GN=ccpp-6 PE=1 SV=2
14	Q5VU57	2.20e-56	206	503	0.110	0.268	CBPC6_HUMAN Cytosolic carboxypeptidase 6 OS=Homo sapiens OX=9606 GN=AGBL4 PE=2 SV=3
15	Q09LZ8	4.51e-56	206	540	0.110	0.250	CBPC6_MOUSE Cytosolic carboxypeptidase 6 OS=Mus musculus OX=10090 GN=Agbl4 PE=1 SV=1
16	Q68EI3	7.14e-40	162	885	0.086	0.119	CBPC5_DANRE Cytosolic carboxypeptidase-like protein 5 OS=Danio rerio OX=7955 GN=agbl5 PE=2 SV=1
17	Q583K9	1.26e-37	154	773	0.112	0.177	Q583K9_TRYB2 Cytosolic carboxypeptidase-like protein 5 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.29M18.130 PE=3 SV=1
18	Q09M02	3.39e-36	150	886	0.086	0.119	CBPC5_MOUSE Cytosolic carboxypeptidase-like protein 5 OS=Mus musculus OX=10090 GN=Agbl5 PE=1 SV=2
19	Q8NDL9	5.15e-36	150	886	0.087	0.121	CBPC5_HUMAN Cytosolic carboxypeptidase-like protein 5 OS=Homo sapiens OX=9606 GN=AGBL5 PE=1 SV=1
20	Q383Q1	6.82e-33	141	1192	0.101	0.104	Q383Q1_TRYB2 Zinc carboxypeptidase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2050 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04952 AstE_AspA	9.7	16.9	Succinylglutamate desuccinylase / Aspartoacylase family
2	PF18704 Chromo_2	5.6e+02	12.1	Chromatin organization modifier domain 2
3	PF18027 Pepdidase_M14_N	3.2e-12	57.9	Cytosolic carboxypeptidase N-terminal domain
4	PF00246 Peptidase_M14	2.7e-10	52.1	Zinc carboxypeptidase
5	PF03224 V-ATPase_H_N	17	16.2	V-ATPase subunit H

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008959622.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003805281.1	0.697	AE binding protein 1
2	9597.XP_003809219.2	0.664	N-alpha-acetyltransferase 35, NatC auxiliary subunit isoform X1
3	9597.XP_008953419.1	0.598	Ubiquitin-associated protein 1 isoform X1
4	9597.XP_003825250.1	0.593	HSPB1-associated protein 1 isoform X1
5	9597.XP_003809352.1	0.581	SNF-related serine/threonine-protein kinase isoform X1
6	9597.XP_003831396.1	0.565	Carboxypeptidase A6
7	9597.XP_003816350.1	0.559	Carboxypeptidase X, M14 family member 2
8	9597.XP_003828553.1	0.559	RNA polymerase II subunit G
9	9597.XP_003812468.1	0.551	Tubulin tyrosine ligase like 1
10	9597.XP_003811291.1	0.508	Rho GTPase-activating protein 24 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004181	1.000	metallocarboxypeptidase activity
GO:0015631	0.996	tubulin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0019538	0.989	protein metabolic process
GO:0036211	0.922	protein modification process
GO:0018200	0.911	peptidyl-glutamic acid modification
GO:0043687	0.801	post-translational protein modification
GO:0009987	0.789	cellular process
GO:0044237	0.630	cellular metabolic process
GO:0050794	0.386	regulation of cellular process
GO:0032501	0.371	multicellular organismal process
GO:0032502	0.333	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0043232	0.994	intracellular non-membrane-bounded organelle
GO:0005737	0.992	cytoplasm
GO:0005730	0.958	nucleolus
GO:0005829	0.469	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.17.-	1.000	Metallocarboxypeptidases.

[back to server]