StarFunc result for job id Q9UPW8

User Input

>input (1703 residues)
MSLLCVGVKKAKFDGAQEKFNTYVTLKVQNVKSTTIAVRGSQPSWEQDFMFEINRLDLGL
TVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGEWLTLDSQVIMADSEICGTKDPTFHR
ILLDTRFELPLDIPEEEARYWAKKLEQLNAMRDQDEYSFQDEQDKPLPVPSNQCCNWNYF
GWGEQHNDDPDSAVDDRDSDYRSETSNSIPPPYYTTSQPNASVHQYSVRPPPLGSRESYS
DSMHSYEEFSEPQALSPTGSSRYASSGELSQGSSQLSEDFDPDEHSLQGSDMEDERDRDS
YHSCHSSVSYHKDSPRWDQDEEELEEDLEDFLEEEELPEDEEELEEEEEEVPDDLGSYAQ
REDVAVAEPKDFKRISLPPAAPGKEDKAPVAPTEAPDMAKVAPKPATPDKVPAAEQIPEA
EPPKDEESFRPREDEEGQEGQDSMSRAKANWLRAFNKVRMQLQEARGEGEMSKSLWFKGG
PGGGLIIIDSMPDIRKRKPIPLVSDLAMSLVQSRKAGITSALASSTLNNEELKNHVYKKT
LQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLN
ADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQEIFAVTKTAHTQQM
KAVKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLN
PVWEENFHFECHNSSDRIKVRVWDEDDDIKSRVKQRFKRESDDFLGQTIIEVRTLSGEMD
VWYNLDKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHFVTDVQNNGVVK
IPDAKGDDAWKVYYDETAQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVPAVMSTL
LANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSP
ERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHELYS
REYQTDPAKKGEVLPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQELNVG
KISAEVMWNLFAQDMKYAMEEHDKHRLCKSADYMNLHFKVKWLYNEYVTELPAFKDRVPE
YPAWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDVFSQLNQSF
EIIKKLECPDPQIVGHYMRRFAKTISNVLLQYADIISKDFASYCSKEKEKVPCILMNNTQ
QLRVQLEKMFEAMGGKELDAEASDILKELQVKLNNVLDELSRVFATSFQPHIEECVKQMG
DILSQVKGTGNVPASACSSVAQDADNVLQPIMDLLDSNLTLFAKICEKTVLKRVLKELWK
LVMNTMEKTIVLPPLTDQTMIGNLLRKHGKGLEKGRVKLPSHSDGTQMIFNAAKELGQLS
KLKDHMVREEAKSLTPKQCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLRYALSL
YTQATDLLIKTFVQTQSAQGLGVEDPVGEVSVHVELFTHPGTGEHKVTVKVVAANDLKWQ
TSGIFRPFIEVNIIGPQLSDKKRKFATKSKNNSWAPKYNESFQFTLSADAGPECYELQVC
VKDYCFAREDRTVGLAVLQLRELAQRGSAACWLPLGRRIHMDDTGLTVLRILSQRSNDEV
AKEFVKLKSDTRSAEEGGAAPAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P27715	0.636	0.506	0.000	2155	0.500	0.395	P27715.pdb.gz	UNC13_CAEEL Phorbol ester/diacylglycerol-binding protein unc-13 OS=Caenorhabditis elegans OX=6239 GN=unc-13 PE=1 SV=4
2	AFDB:Q62768	0.819	0.804	0.000	1735	0.957	0.939	Q62768.pdb.gz	UN13A_RAT Protein unc-13 homolog A OS=Rattus norvegicus OX=10116 GN=Unc13a PE=1 SV=1
3	AFDB:Q62769	0.679	0.712	0.000	1622	0.728	0.764	Q62769.pdb.gz	UN13B_RAT Protein unc-13 homolog B OS=Rattus norvegicus OX=10116 GN=Unc13b PE=1 SV=2
4	AFDB:Q9UPW8	1.000	1.000	0.000	1703	1.000	1.000	Q9UPW8.pdb.gz	UN13A_HUMAN Protein unc-13 homolog A OS=Homo sapiens OX=9606 GN=UNC13A PE=2 SV=4
5	AFDB:Q9Z1N9	0.676	0.717	0.000	1602	0.730	0.777	Q9Z1N9.pdb.gz	UN13B_MOUSE Protein unc-13 homolog B OS=Mus musculus OX=10090 GN=Unc13b PE=1 SV=2
6	AFDB:Q22366	0.049	0.053	1.338E-7	1563	0.060	0.065	Q22366.pdb.gz	RIM_CAEEL Rab-3-interacting molecule unc-10 OS=Caenorhabditis elegans OX=6239 GN=unc-10 PE=2 SV=2
7	AFDB:Q9JIS1	0.051	0.055	1.514E-7	1555	0.069	0.076	Q9JIS1.pdb.gz	RIMS2_RAT Regulating synaptic membrane exocytosis protein 2 OS=Rattus norvegicus OX=10116 GN=Rims2 PE=1 SV=1
8	PDB:1cjyA	0.065	0.167	2.237E-7	633	0.032	0.085	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
9	AFDB:Q9JIR4	0.056	0.058	8.557E-7	1615	0.075	0.079	Q9JIR4.pdb.gz	RIMS1_RAT Regulating synaptic membrane exocytosis protein 1 OS=Rattus norvegicus OX=10116 GN=Rims1 PE=1 SV=1
10	AFDB:Q9BXF6	0.063	0.153	2.034E-6	653	0.043	0.113	Q9BXF6.pdb.gz	RFIP5_HUMAN Rab11 family-interacting protein 5 OS=Homo sapiens OX=9606 GN=RAB11FIP5 PE=1 SV=1
11	PDB:5a50A	0.062	0.543	3.132E-6	165	0.018	0.188	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
12	PDB:3pfqA	0.070	0.217	4.180E-6	523	0.017	0.055	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
13	AFDB:Q99NE5	0.054	0.062	6.725E-6	1463	0.081	0.094	Q99NE5.pdb.gz	RIMS1_MOUSE Regulating synaptic membrane exocytosis protein 1 OS=Mus musculus OX=10090 GN=Rims1 PE=1 SV=2
14	PDB:5a52A	0.060	0.572	1.125E-5	154	0.018	0.195	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
15	PDB:3nsjA	0.062	0.195	1.382E-5	530	0.018	0.058	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
16	PDB:5izrC	0.064	0.160	1.845E-5	659	0.015	0.039	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
17	PDB:5ixcA	0.065	0.157	2.175E-5	684	0.015	0.038	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
18	PDB:7cunG	0.066	0.101	2.175E-5	895	0.062	0.118	7cunG.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
19	PDB:5iz5B	0.067	0.148	2.565E-5	746	0.016	0.036	5iz5B.pdb.gz
20	PDB:4rj9A	0.062	0.554	2.903E-5	161	0.018	0.186	4rj9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	G5EDN9	1506	1819	0.427	0.400	G5EDN9_CAEEL Phorbol ester/diacylglycerol-binding protein unc-13 OS=Caenorhabditis elegans OX=6239 GN=unc-13 PE=1 SV=1
2	H9XVP2	1795	3186	0.500	0.267	H9XVP2_DROME Unc-13, isoform E OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=4 SV=1
3	L0MPR2	1402	2711	0.389	0.245	L0MPR2_DROME Unc-13, isoform F OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=4 SV=1
4	O14795	2516	1591	0.730	0.782	UN13B_HUMAN Protein unc-13 homolog B OS=Homo sapiens OX=9606 GN=UNC13B PE=1 SV=2
5	O96959	1760	1304	0.495	0.646	O96959_DROME UNC-13 protein (Fragment) OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=2 SV=1
6	O96960	1752	1724	0.490	0.484	O96960_DROME UNC-13-B protein (Fragment) OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=2 SV=1
7	P27715	1508	2155	0.427	0.338	UNC13_CAEEL Phorbol ester/diacylglycerol-binding protein unc-13 OS=Caenorhabditis elegans OX=6239 GN=unc-13 PE=1 SV=4
8	Q4KUS2	3290	1712	0.956	0.951	UN13A_MOUSE Protein unc-13 homolog A OS=Mus musculus OX=10090 GN=Unc13a PE=1 SV=3
9	Q62768	3301	1735	0.955	0.938	UN13A_RAT Protein unc-13 homolog A OS=Rattus norvegicus OX=10116 GN=Unc13a PE=1 SV=1
10	Q62769	2533	1622	0.732	0.768	UN13B_RAT Protein unc-13 homolog B OS=Rattus norvegicus OX=10116 GN=Unc13b PE=1 SV=2
11	Q62770	1899	2204	0.538	0.416	UN13C_RAT Protein unc-13 homolog C OS=Rattus norvegicus OX=10116 GN=Unc13c PE=1 SV=3
12	Q8IM86	1797	3183	0.501	0.268	Q8IM86_DROME Unc-13, isoform B OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=4 SV=1
13	Q8IM87	1786	2871	0.499	0.296	Q8IM87_DROME Unc-13, isoform A OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=4 SV=1
14	Q8K0T7	1915	2210	0.538	0.415	UN13C_MOUSE Protein unc-13 homolog C OS=Mus musculus OX=10090 GN=Unc13c PE=1 SV=3
15	Q8NB66	1903	2214	0.523	0.402	UN13C_HUMAN Protein unc-13 homolog C OS=Homo sapiens OX=9606 GN=UNC13C PE=2 SV=3
16	Q8T049	1775	1508	0.499	0.563	Q8T049_DROME LD28927p OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=2 SV=1
17	Q9U4K9	1719	1752	0.494	0.480	Q9U4K9_DROME UNC-13 OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=2 SV=1
18	Q9UPW8	3560	1703	1.000	1.000	UN13A_HUMAN Protein unc-13 homolog A OS=Homo sapiens OX=9606 GN=UNC13A PE=2 SV=4
19	Q9V483	1807	2874	0.505	0.299	Q9V483_DROME Unc-13, isoform C OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=4 SV=4
20	Q9Z1N9	2141	1602	0.600	0.637	UN13B_MOUSE Protein unc-13 homolog B OS=Mus musculus OX=10090 GN=Unc13b PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17675 APG6_N	10	18.0	Apg6 coiled-coil region
2	PF00130 C1_1	1.1e-07	42.9	Phorbol esters/diacylglycerol binding domain (C1 domain)
3	PF00168 C2	1.9e-52	187.2	C2 domain
4	PF06292 MUN	3e-153	522.4	MUN domain
5	PF05402 PqqD	7.8e+02	11.8	Coenzyme PQQ synthesis protein D (PqqD)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000429562

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000428417	0.984	Regulating synaptic membrane exocytosis protein 1
2	9606.ENSP00000262231	0.974	Regulating synaptic membrane exocytosis protein 2
3	9606.ENSP00000296452	0.961	Protein bassoon
4	9606.ENSP00000222256	0.960	Ras-related protein Rab-3A
5	9606.ENSP00000362399	0.960	Syntaxin-binding protein 1
6	9606.ENSP00000222812	0.877	Syntaxin-1A
7	9606.ENSP00000349467	0.876	Calmodulin-1
8	9606.ENSP00000272298	0.869	Calmodulin 2 (phosphorylase kinase, delta)
9	9606.ENSP00000291295	0.869	Calmodulin 3 (phosphorylase kinase, delta)
10	9606.ENSP00000215095	0.864	Syntaxin-1B
11	9606.ENSP00000254976	0.847	Synaptosomal-associated protein 25
12	9606.ENSP00000261205	0.841	Synaptotagmin-1
13	9606.ENSP00000260323	0.835	Protein unc-13 homolog C
14	9606.ENSP00000468263	0.821	ELKS/Rab6-interacting/CAST family member 1
15	9606.ENSP00000367756	0.803	Protein unc-13 homolog B
16	9606.ENSP00000288221	0.788	ERC protein 2
17	9606.ENSP00000356236	0.783	Synaptotagmin-2
18	9606.ENSP00000261655	0.750	RIMS-binding protein 2
19	9606.ENSP00000305613	0.746	Complexin-1
20	9606.ENSP00000455711	0.744	Transcriptional repressor scratch 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005516	1.000	calmodulin binding
GO:0000149	0.854	SNARE binding
GO:0019905	0.841	syntaxin binding
GO:0017075	0.823	syntaxin-1 binding
GO:0008289	0.781	lipid binding
GO:0008092	0.416	cytoskeletal protein binding
GO:0044877	0.370	protein-containing complex binding
GO:0042802	0.332	identical protein binding
GO:0030507	0.305	spectrin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0007267	0.979	cell-cell signaling
GO:0006810	0.969	transport
GO:0016079	0.959	synaptic vesicle exocytosis
GO:0017156	0.937	calcium-ion regulated exocytosis
GO:1903530	0.887	regulation of secretion by cell
GO:0140029	0.866	exocytic process
GO:1903532	0.863	positive regulation of secretion by cell
GO:0071840	0.823	cellular component organization or biogenesis
GO:0050804	0.780	modulation of chemical synaptic transmission
GO:0051640	0.766	organelle localization
GO:0051128	0.759	regulation of cellular component organization
GO:0016043	0.758	cellular component organization
GO:0065003	0.624	protein-containing complex assembly
GO:0050896	0.617	response to stimulus
GO:0050806	0.548	positive regulation of synaptic transmission
GO:0048167	0.525	regulation of synaptic plasticity
GO:0051094	0.492	positive regulation of developmental process
GO:0044087	0.449	regulation of cellular component biogenesis
GO:0032501	0.352	multicellular organismal process
GO:0051716	0.313	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098793	1.000	presynapse
GO:0048786	0.989	presynaptic active zone
GO:0120025	0.981	plasma membrane bounded cell projection
GO:0005737	0.980	cytoplasm
GO:0016020	0.975	membrane
GO:0043226	0.966	organelle
GO:0030424	0.962	axon
GO:0005886	0.959	plasma membrane
GO:0044306	0.956	neuron projection terminus
GO:0043679	0.946	axon terminus
GO:0043227	0.930	membrane-bounded organelle
GO:0043231	0.906	intracellular membrane-bounded organelle
GO:0005829	0.868	cytosol
GO:0012505	0.862	endomembrane system
GO:0031982	0.676	vesicle
GO:0097708	0.671	intracellular vesicle
GO:0031410	0.664	cytoplasmic vesicle
GO:0098590	0.560	plasma membrane region
GO:0032991	0.422	protein-containing complex
GO:0043233	0.346	organelle lumen
GO:0043195	0.321	terminal bouton
GO:0097060	0.316	synaptic membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]