StarFunc result for job id Q9UPX0

User Input

>input (1349 residues)
MIWYVATFIASVIGTRGLAAEGAHGLREEPEFVTARAGESVVLRCDVIHPVTGQPPPYVV
EWFKFGVPIPIFIKFGYYPPHVDPEYAGRASLHDKASLRLEQVRSEDQGWYECKVLMLDQ
QYDTFHNGSWVHLTINAPPTFTETPPQYIEAKEGGSITMTCTAFGNPKPIVTWLKEGTLL
GASGKYQVSDGSLTVTSVSREDRGAYTCRAYSIQGEAVHTTHLLVQGPPFIVSPPENITV
NISQDALLTCRAEAYPGNLTYTWYWQDENVYFQNDLKLRVRILIDGTLIIFRVKPEDSGK
YTCVPSNSLGRSPSASAYLTVQYPARVLNMPPVIYVPVGIHGYIRCPVDAEPPATVVKWN
KDGRPLQVEKNLGWTLMEDGSIRIEEATEEALGTYTCVPYNTLGTMGQSAPARLVLKDPP
YFTVLPGWEYRQEAGRELLIPCAAAGDPFPVITWRKVGKPSRSKHSALPSGSLQFRALSK
EDHGEWECVATNVVTSITASTHLTVIGTSPHAPGSVRVQVSMTTANVSWEPGYDGGYEQT
FSVWMKRAQFGPHDWLSLPVPPGPSWLLVDTLEPETAYQFSVLAQNKLGTSAFSEVVTVN
TLAFPITTPEPLVLVTPPRCLIANRTQQGVLLSWLPPANHSFPIDRYIMEFRVAERWELL
DDGIPGTEGEFFAKDLSQDTWYEFRVLAVMQDLISEPSNIAGVSSTDIFPQPDLTEDGLA
RPVLAGIVATICFLAAAILFSTLAACFVNKQRKRKLKRKKDPPLSITHCRKSLESPLSSG
KVSPESIRTLRAPSESSDDQGQPAAKRMLSPTREKELSLYKKTKRAISSKKYSVAKAEAE
AEATTPIELISRGPDGRFVMDPAEMEPSLKSRRIEGFPFAEETDMYPEFRQSDEENEDPL
VPTSVAALKSQLTPLSSSQESYLPPPAYSPRFQPRGLEGPGGLEGRLQATGQARPPAPRP
FHHGQYYGYLSSSSPGEVEPPPFYVPEVGSPLSSVMSSPPLPTEGPFGHPTIPEENGENA
SNSTLPLTQTPTGGRSPEPWGRPEFPFGGLETPAMMFPHQLPPCDVPESLQPKAGLPRGL
PPTSLQVPAAYPGILSLEAPKGWAGKSPGRGPVPAPPAAKWQDRPMQPLVSQGQLRHTSQ
GMGIPVLPYPEPAEPGAHGGPSTFGLDTRWYEPQPRPRPSPRQARRAEPSLHQVVLQPSR
LSPLTQSPLSSRTGSPELAARARPRPGLLQQAEMSEITLQPPAAVSFSRKSTPSTGSPSQ
SSRSGSPSYRPAMGFTTLATGYPSPPPGPAPAGPGDSLDVFGQTPSPRRTGEELLRPETP
PPTLPTSGKLQRDRPAPATSPPERALSKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZB51	0.453	0.460	0.000	1328	0.944	0.959	D3ZB51.pdb.gz	TUTLB_RAT Protein turtle homolog B OS=Rattus norvegicus OX=10116 GN=Igsf9b PE=1 SV=1
2	AFDB:Q967D7	0.298	0.270	4.498E-82	1531	0.259	0.229	Q967D7.pdb.gz	TUTL_DROME Protein turtle OS=Drosophila melanogaster OX=7227 GN=tutl PE=1 SV=2
3	AFDB:Q9W213	0.171	0.166	2.950E-52	1395	0.198	0.191	Q9W213.pdb.gz	Q9W213_DROME Roundabout 1, isoform A OS=Drosophila melanogaster OX=7227 GN=robo1 PE=1 SV=3
4	AFDB:F1R2D2	0.151	0.129	5.521E-52	1687	0.209	0.167	F1R2D2.pdb.gz
5	AFDB:A0A2R8QRK0	0.176	0.169	8.311E-50	1420	0.195	0.185	A0A2R8QRK0.pdb.gz	A0A2R8QRK0_DANRE Roundabout homolog 3 isoform X3 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
6	AFDB:Q96MS0	0.161	0.159	1.222E-49	1386	0.204	0.198	Q96MS0.pdb.gz	ROBO3_HUMAN Roundabout homolog 3 OS=Homo sapiens OX=9606 GN=ROBO3 PE=1 SV=2
7	AFDB:Q9Z2I4	0.154	0.152	2.003E-48	1366	0.205	0.203	Q9Z2I4.pdb.gz	ROBO3_MOUSE Roundabout homolog 3 OS=Mus musculus OX=10090 GN=Robo3 PE=1 SV=2
8	PDB:5oj2B	0.145	0.241	7.220E-29	692	0.097	0.189	5oj2B.pdb.gz
9	AFDB:Q6WRI0	0.128	0.075	2.057E-25	2623	0.099	0.051	Q6WRI0.pdb.gz	IGS10_HUMAN Immunoglobulin superfamily member 10 OS=Homo sapiens OX=9606 GN=IGSF10 PE=1 SV=1
10	PDB:1e07A	0.172	0.294	4.137E-23	642	0.088	0.185	1e07A.pdb.gz
11	AFDB:F6ZNL5	0.104	0.105	5.796E-23	1338	0.153	0.154	F6ZNL5.pdb.gz	F6ZNL5_MOUSE Protocadherin 11 X-linked OS=Mus musculus OX=10090 GN=Pcdh11x PE=1 SV=1
12	AFDB:Q99PJ1	0.107	0.083	7.831E-22	1943	0.156	0.108	Q99PJ1.pdb.gz	PCD15_MOUSE Protocadherin-15 OS=Mus musculus OX=10090 GN=Pcdh15 PE=1 SV=3
13	PDB:6dldD	0.154	0.623	2.517E-16	269	0.053	0.268	6dldD.pdb.gz
14	PDB:7sqcO0	0.134	0.149	1.428E-15	1140	0.078	0.092	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
15	PDB:6dlfA	0.148	0.715	1.817E-15	236	0.059	0.335	6dlfA.pdb.gz
16	PDB:7q1yA	0.112	0.111	5.248E-15	1374	0.064	0.063	7q1yA.pdb.gz
17	PDB:7nycA	0.127	0.116	1.534E-13	1542	0.063	0.055	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
18	PDB:6h03A	0.133	0.143	1.609E-13	1223	0.070	0.077	6h03A.pdb.gz
19	PDB:4lnvA	0.121	0.126	2.606E-13	1276	0.060	0.063	4lnvA.pdb.gz
20	PDB:7q5zA	0.128	0.129	6.836E-13	1344	0.061	0.061	7q5zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZB51	0.0	2437	1328	0.942	0.957	TUTLB_RAT Protein turtle homolog B OS=Rattus norvegicus OX=10116 GN=Igsf9b PE=1 SV=1
2	E9PZ19	0.0	2446	1328	0.944	0.959	TUTLB_MOUSE Protein turtle homolog B OS=Mus musculus OX=10090 GN=Igsf9b PE=1 SV=1
3	Q05BQ1	0.0	720	1179	0.305	0.349	TUTLA_MOUSE Protein turtle homolog A OS=Mus musculus OX=10090 GN=Igsf9 PE=1 SV=2
4	Q9P2J2	0.0	728	1179	0.308	0.352	TUTLA_HUMAN Protein turtle homolog A OS=Homo sapiens OX=9606 GN=IGSF9 PE=1 SV=2
5	Q967D7	1.10e-128	436	1531	0.192	0.169	TUTL_DROME Protein turtle OS=Drosophila melanogaster OX=7227 GN=tutl PE=1 SV=2
6	Q9U4G1	1.33e-54	206	719	0.134	0.252	BDL_DROME Protein borderless OS=Drosophila melanogaster OX=7227 GN=bdl PE=1 SV=1
7	A2AJ76	4.27e-38	159	5100	0.111	0.029	HMCN2_MOUSE Hemicentin-2 OS=Mus musculus OX=10090 GN=Hmcn2 PE=1 SV=1
8	Q96RW7	5.83e-38	159	5635	0.102	0.024	HMCN1_HUMAN Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2
9	D3YXG0	3.59e-37	156	5634	0.090	0.021	HMCN1_MOUSE Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1
10	Q49BB0	1.77e-36	153	1421	0.120	0.114	Q49BB0_DANRE Deleted in colorectal cancer OS=Danio rerio OX=7955 GN=zdcc PE=1 SV=1
11	Q2EY15	3.22e-36	152	1191	0.116	0.131	PRTG_MOUSE Protogenin OS=Mus musculus OX=10090 GN=Prtg PE=2 SV=1
12	A0A0B4K7H9	6.09e-36	152	2030	0.133	0.088	A0A0B4K7H9_DROME Down syndrome cell adhesion molecule 1, isoform BI OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
13	E7F3V2	8.85e-36	151	4212	0.109	0.035	E7F3V2_DANRE Hemicentin 2 OS=Danio rerio OX=7955 GN=hmcn2 PE=1 SV=2
14	Q0E9K1	9.31e-36	151	2030	0.133	0.089	Q0E9K1_DROME Down syndrome cell adhesion molecule 1, isoform BD OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
15	A0A0B4K827	1.10e-35	150	2028	0.133	0.089	A0A0B4K827_DROME Down syndrome cell adhesion molecule 1, isoform BM OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
16	Q0E9M0	1.26e-35	150	2030	0.133	0.089	Q0E9M0_DROME Down syndrome cell adhesion molecule 1, isoform BC OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
17	Q0E9J2	2.27e-35	150	2031	0.136	0.090	Q0E9J2_DROME Down syndrome cell adhesion molecule 1, isoform BG OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
18	Q0E9I9	2.68e-35	149	2031	0.138	0.092	Q0E9I9_DROME Down syndrome cell adhesion molecule 1, isoform X OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
19	Q0E9H8	2.80e-35	149	2031	0.136	0.090	Q0E9H8_DROME Down syndrome cell adhesion molecule 1, isoform BF OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
20	Q0E9I5	2.84e-35	149	2013	0.138	0.092	Q0E9I5_DROME Down syndrome cell adhesion molecule 1, isoform R OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	0.0044	28.4	CD80-like C2-set immunoglobulin domain
2	PF00041 fn3	8.2e-10	50.2	Fibronectin type III domain
3	PF07679 I-set	2.1e-51	183.3	Immunoglobulin I-set domain
4	PF00047 ig	6.3e-35	130.5	Immunoglobulin domain
5	PF13895 Ig_2	1.2e-38	142.6	Immunoglobulin domain
6	PF13927 Ig_3	6.4e-61	214.2	Immunoglobulin domain
7	PF16680 Ig_4	0.0027	29.6	T-cell surface glycoprotein CD3 delta chain
8	PF18452 Ig_6	0.4	21.9	Immunoglobulin domain
9	PF17736 Ig_C17orf99	4	18.9	C17orf99 Ig domain
10	PF16706 Izumo-Ig	0.071	24.4	Izumo-like Immunoglobulin domain
11	PF13940 Ldr_toxin	2.1e+02	13.4	Toxin Ldr, type I toxin-antitoxin system
12	PF16656 Pur_ac_phosph_N	1.6e+02	14.3	Purple acid Phosphatase, N-terminal domain
13	PF01108 Tissue_fac	1.9e+02	13.4	Tissue factor
14	PF07686 V-set	3.2e-25	99.8	Immunoglobulin V-set domain
15	PF08204 V-set_CD47	5.1e+02	12.0	CD47 immunoglobulin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000018915

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000006708	0.692	Uncharacterized protein
2	9593.ENSGGOP00000028097	0.668	NPHS1, nephrin
3	9593.ENSGGOP00000027436	0.656	Uncharacterized protein
4	9593.ENSGGOP00000006085	0.653	Uncharacterized protein
5	9593.ENSGGOP00000028733	0.649	Uncharacterized protein
6	9593.ENSGGOP00000006388	0.638	Semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group)
7	9593.ENSGGOP00000011511	0.612	Neuroligin 2
8	9593.ENSGGOP00000008996	0.575	LHFPL tetraspan subfamily member 4
9	9593.ENSGGOP00000001284	0.570	Membrane associated guanylate kinase, WW and PDZ domain containing 2
10	9593.ENSGGOP00000001845	0.562	RNA binding motif protein 46
11	9593.ENSGGOP00000009733	0.543	Glutamate receptor, ionotropic, N-methyl D-aspartate 2B
12	9593.ENSGGOP00000014169	0.543	Ubiquitin-like domain containing CTD phosphatase 1
13	9593.ENSGGOP00000003632	0.531	Distal-less homeobox 1
14	9593.ENSGGOP00000026379	0.528	NLR family, pyrin domain containing 9
15	9593.ENSGGOP00000009975	0.527	Catalyzes two steps in the biosynthesis of the molybdenum cofactor. In the first step, molybdopterin is adenylated. Subsequently, molybdate is inserted into adenylated molybdopterin and AMP is released
16	9593.ENSGGOP00000011210	0.502	Protein tyrosine phosphatase, receptor type, Q
17	9593.ENSGGOP00000020993	0.501	Extracellular leucine-rich repeat and fibronectin type III domain containing 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0050839	0.338	cell adhesion molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0065007	0.978	biological regulation
GO:0050794	0.961	regulation of cellular process
GO:0007155	0.925	cell adhesion
GO:0071840	0.848	cellular component organization or biogenesis
GO:0098609	0.843	cell-cell adhesion
GO:0034330	0.838	cell junction organization
GO:0007156	0.742	homophilic cell adhesion via plasma membrane adhesion molecules
GO:0050808	0.717	synapse organization
GO:0023051	0.701	regulation of signaling
GO:0010646	0.701	regulation of cell communication
GO:0065008	0.686	regulation of biological quality
GO:0032501	0.665	multicellular organismal process
GO:0051239	0.475	regulation of multicellular organismal process
GO:0032502	0.408	developmental process
GO:0048856	0.368	anatomical structure development
GO:0048518	0.349	positive regulation of biological process
GO:0050896	0.332	response to stimulus
GO:0007275	0.322	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0045202	0.996	synapse
GO:0043226	0.991	organelle
GO:0042995	0.979	cell projection
GO:0098982	0.937	GABA-ergic synapse
GO:0016020	0.928	membrane
GO:0120025	0.909	plasma membrane bounded cell projection
GO:0043005	0.836	neuron projection
GO:0036477	0.765	somatodendritic compartment
GO:0005886	0.720	plasma membrane
GO:0005622	0.698	intracellular anatomical structure
GO:0030425	0.511	dendrite
GO:0060077	0.505	inhibitory synapse
GO:0043227	0.501	membrane-bounded organelle
GO:0043229	0.497	intracellular organelle
GO:0098794	0.465	postsynapse
GO:0099572	0.456	postsynaptic specialization
GO:0098984	0.445	neuron to neuron synapse
GO:0099629	0.385	postsynaptic specialization of symmetric synapse
GO:0044297	0.348	cell body
GO:0005737	0.342	cytoplasm
GO:0043025	0.331	neuronal cell body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]