StarFunc result for job id Q9UPX6

User Input

>input (916 residues)
METSQETSLFLVKILEELDSKQNTVSYQDLCKSLCARFDLSQLAKLRSVLFYTACLDPNF
PATLFKDKMKCTVNNQQSKKIMVAADIVTIFNLIQMNGGAAKEKLPTGRQKVRKKEASFE
SCRSDTEICNAAECEPLNCELSERSFSRGYPIRQSSKCRKMDCKDCPQFVPASEPNFLLG
VSKEVKNRAASLDRLQALAPYSVTSPQPCEMQRTYFPMNIENESISDQDSLPINQSIKET
FISNEEPFVVQSCVQKRNIFKEDFHNLMAVSPSLVGPISKAENEHREPQSRKEPHKPPFF
NHSFEMPYNSQYLNPVYSPVPDKRRAKHESLDDLQASTYFGPTPVMGTQEARRCLGKPNK
QTPWPAKSWSLNTEEVPDFERSFFNRNPSEEKLHYPNASSQTPNFPAPERRPTYLVPKDQ
QPILPIAYAAKQNGLKSKEISSPVDLEKHEPVKKFKDKSINCTSGQLSSDTSSVGTQTEH
VLEPKKCRDLCTSGQGKYSDRHTMKHSDDDSEIVSDDISDIFRFLDDMSISGSTGVIQSS
CYNSTGSLSQLHKSDCDSSPEHNLTKIANGVPNSKGDKGNRPENTHHSEEELKTSVCKLV
LRIGEIERKLESLSGVRDEISQVLGKLNKLDQKMQQPEKVSVQIDLNSLTSEGPSDDSAS
PRMFHAHSGSHGPKLENNPDWCCSDASGSNSESLRVKALKKSLFTRPSSRSLTEENSATE
SKIASISNSPRDWRTITYTNRVGLNEEEIKDTGPGDNKDWHRKSKEADRQYDIPPQHRLP
KQPKDGFLVEQVFSPHPYPASLKAHMKSNPLYTDMRLTELAEVKRGQPSWTIEEYARNAG
DKGKLTALDLQTQESLNPNNLEYWMEDIYTPGYDSLLKRKEAEFRRAKVCKIAALIAAAA
CTVILVIVVPICTMKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UPX6	0.999	0.999	0.000	916	1.000	1.000	Q9UPX6.pdb.gz	MNAR1_HUMAN Major intrinsically disordered Notch2-binding receptor 1 OS=Homo sapiens OX=9606 GN=MINAR1 PE=1 SV=3
2	AFDB:D3ZJ47	0.333	0.333	2.119E-96	917	0.898	0.897	D3ZJ47.pdb.gz	MNAR1_RAT Major intrinsically disordered Notch2-binding receptor 1 OS=Rattus norvegicus OX=10116 GN=Minar1 PE=2 SV=3
3	AFDB:A0A2R8RUQ1	0.062	0.067	2.670E-5	828	0.122	0.135	A0A2R8RUQ1.pdb.gz
4	AFDB:P34333	0.056	0.034	2.834E-5	1778	0.130	0.067	P34333.pdb.gz	NCOR1_CAEEL Nuclear receptor corepressor 1 OS=Caenorhabditis elegans OX=6239 GN=gei-8 PE=1 SV=4
5	AFDB:Q10728	0.073	0.067	5.784E-5	1032	0.131	0.116	Q10728.pdb.gz	MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus OX=10116 GN=Ppp1r12a PE=1 SV=2
6	AFDB:P39083	0.068	0.063	2.271E-4	1007	0.112	0.102	P39083.pdb.gz	RGA1_YEAST Rho-type GTPase-activating protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RGA1 PE=1 SV=1
7	AFDB:A0A2R8QB31	0.058	0.063	2.558E-4	797	0.114	0.130	A0A2R8QB31.pdb.gz	A0A2R8QB31_DANRE PHD finger protein 21A isoform X7 OS=Danio rerio OX=7955 GN=phf21ab PE=1 SV=1
8	AFDB:Q6DRG7	0.077	0.069	5.879E-4	1049	0.130	0.113	Q6DRG7.pdb.gz	MYPT1_DANRE Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio OX=7955 GN=ppp1r12a PE=2 SV=2
9	AFDB:Q5T5Y3	0.063	0.039	1.065E-3	1602	0.143	0.082	Q5T5Y3.pdb.gz	CAMP1_HUMAN Calmodulin-regulated spectrin-associated protein 1 OS=Homo sapiens OX=9606 GN=CAMSAP1 PE=1 SV=2
10	AFDB:F4I171	0.065	0.050	1.931E-3	1335	0.152	0.104	F4I171.pdb.gz	MD15A_ARATH Mediator of RNA polymerase II transcription subunit 15a OS=Arabidopsis thaliana OX=3702 GN=MED15A PE=1 SV=1
11	PDB:6ox1B	0.039	0.070	6.888E-1	484	0.012	0.023	6ox1B.pdb.gz	Structural basis for the target specificity of actin histidine methyltransferase SETD3.
12	PDB:4wmuA	0.048	0.074	8.233E-1	516	0.020	0.035	4wmuA.pdb.gz	A Maltose-Binding Protein Fusion Construct Yields a Robust Crystallography Platform for MCL1.
13	PDB:4jaeA	0.037	0.068	9.840E-1	426	0.019	0.040	4jaeA.pdb.gz	Enzyme-substrate complexes of allosteric citrate synthase: Evidence for a novel intermediate in substrate binding.
14	PDB:1rhgB	0.051	0.211	1.492	144	0.019	0.118	1rhgB.pdb.gz
15	PDB:7odrY	0.042	0.157	1.783	181	0.014	0.072	7odrY.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
16	PDB:7tzfE	0.043	0.217	1.783	114	0.015	0.123	7tzfE.pdb.gz	A structural basis for amylin receptor phenotype.
17	PDB:4nooB	0.047	0.292	2.132	95	0.017	0.168	4nooB.pdb.gz
18	PDB:5a63D	0.045	0.247	2.262	100	0.019	0.170	5a63D.pdb.gz
19	PDB:5v3hA	0.051	0.095	2.262	438	0.023	0.048	5v3hA.pdb.gz	Small molecule inhibitors and CRISPR/Cas9 mutagenesis demonstrate that SMYD2 and SMYD3 activity are dispensable for autonomous cancer cell proliferation.
20	PDB:6ybwz	0.046	0.188	2.262	160	0.025	0.144	6ybwz.pdb.gz	Structure of a human 48Stranslational initiation complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZJ47	0.0	1719	917	0.900	0.899	MNAR1_RAT Major intrinsically disordered Notch2-binding receptor 1 OS=Rattus norvegicus OX=10116 GN=Minar1 PE=2 SV=3
2	Q9UPX6	0.0	1905	916	1.000	1.000	MNAR1_HUMAN Major intrinsically disordered Notch2-binding receptor 1 OS=Homo sapiens OX=9606 GN=MINAR1 PE=1 SV=3
3	Q9F837	2.0	34.3	374	0.024	0.059	MEDII_MICMH dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase OS=Micromonospora megalomicea subsp. nigra OX=136926 GN=megDII PE=1 SV=1
4	Q91Y74	5.5	32.7	333	0.031	0.084	SIA4C_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Mus musculus OX=10090 GN=St3gal4 PE=1 SV=1
5	P61131	8.6	32.3	333	0.026	0.072	SIA4C_RAT CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St3gal4 PE=1 SV=1
6	Q9LKB9	8.6	32.7	1505	0.023	0.014	MYO6_ARATH Myosin-6 OS=Arabidopsis thaliana OX=3702 GN=XI-2 PE=1 SV=1
7	F4K7C5	8.9	32.7	1565	0.023	0.013	F4K7C5_ARATH Myosin 2 OS=Arabidopsis thaliana OX=3702 GN=MYA2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06789 MINAR1_C	6.5e-64	226.3	MINAR1 C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 10090.ENSMUSP00000046111

Rank	PPI partner	STRING score	Description
1	10090.ENSMUSP00000045523	0.618	Beta-defensin 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.969	biological regulation
GO:0050794	0.961	regulation of cellular process
GO:0051128	0.841	regulation of cellular component organization
GO:0051171	0.838	regulation of nitrogen compound metabolic process
GO:0080090	0.836	regulation of primary metabolic process
GO:0060255	0.835	regulation of macromolecule metabolic process
GO:0048523	0.831	negative regulation of cellular process
GO:0009987	0.815	cellular process
GO:1903320	0.680	regulation of protein modification by small protein conjugation or removal
GO:0032006	0.680	regulation of TOR signaling
GO:0009968	0.644	negative regulation of signal transduction
GO:0032007	0.576	negative regulation of TOR signaling
GO:0031397	0.560	negative regulation of protein ubiquitination
GO:0050793	0.325	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0043229	0.767	intracellular organelle
GO:0043227	0.759	membrane-bounded organelle
GO:0043231	0.405	intracellular membrane-bounded organelle
GO:0030054	0.360	cell junction
GO:0045202	0.347	synapse
GO:0042995	0.343	cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]