StarFunc result for job id Q9UPX8

User Input

>input (1470 residues)
MKSLLNAFTKKEVPFREAPAYSNRRRRPPNTLAAPRVLLRSNSDNNLNASAPDWAVCSTA
TSHRSLSPQLLQQMPSKPEGAAKTIGSYVPGPRSRSPSLNRLGGAGEDGKRPQPLWHVGS
PFALGANKDSLSAFEYPGPKRKLYSAVPGRLFVAVKPYQPQVDGEIPLHRGDRVKVLSIG
EGGFWEGSARGHIGWFPAECVEEVQCKPRDSQAETRADRSKKLFRHYTVGSYDSFDTSSD
CIIEEKTVVLQKKDNEGFGFVLRGAKADTPIEEFTPTPAFPALQYLESVDEGGVAWQAGL
RTGDFLIEVNNENVVKVGHRQVVNMIRQGGNHLVLKVVTVTRNLDPDDTARKKAPPPPKR
APTTALTLRSKSMTSELEELVDKASVRKKKDKPEEIVPASKPSRAAENMAVEPRVATIKQ
RPSSRCFPAGSDMNSVYERQGIAVMTPTVPGSPKAPFLGIPRGTMRRQKSIDSRIFLSGI
TEEERQFLAPPMLKFTRSLSMPDTSEDIPPPPQSVPPSPPPPSPTTYNCPKSPTPRVYGT
IKPAFNQNSAAKVSPATRSDTVATMMREKGMYFRRELDRYSLDSEDLYSRNAGPQANFRN
KRGQMPENPYSEVGKIASKAVYVPAKPARRKGMLVKQSNVEDSPEKTCSIPIPTIIVKEP
STSSSGKSSQGSSMEIDPQAPEPPSQLRPDESLTVSSPFAAAIAGAVRDREKRLEARRNS
PAFLSTDLGDEDVGLGPPAPRTRPSMFPEEGDFADEDSAEQLSSPMPSATPREPENHFVG
GAEASAPGEAGRPLNSTSKAQGPESSPAVPSASSGTAGPGNYVHPLTGRLLDPSSPLALA
LSARDRAMKESQQGPKGEAPKADLNKPLYIDTKMRPSLDAGFPTVTRQNTRGPLRRQETE
NKYETDLGRDRKGDDKKNMLIDIMDTSQQKSAGLLMVHTVDATKLDNALQEEDEKAEVEM
KPDSSPSEVPEGVSETEGALQISAAPEPTTVPGRTIVAVGSMEEAVILPFRIPPPPLASV
DLDEDFIFTEPLPPPLEFANSFDIPDDRAASVPALSDLVKQKKSDTPQSPSLNSSQPTNS
ADSKKPASLSNCLPASFLPPPESFDAVADSGIEEVDSRSSSDHHLETTSTISTVSSISTL
SSEGGENVDTCTVYADGQAFMVDKPPVPPKPKMKPIIHKSNALYQDALVEEDVDSFVIPP
PAPPPPPGSAQPGMAKVLQPRTSKLWGDVTEIKSPILSGPKANVISELNSILQQMNREKL
AKPGEGLDSPMGAKSASLAPRSPEIMSTISGTRSTTVTFTVRPGTSQPITLQSRPPDYES
RTSGTRRAPSPVVSPTEMNKETLPAPLSAATASPSPALSDVFSLPSQPPSGDLFGLNPAG
RSRSPSPSILQQPISNKPFTTKPVHLWTKPDVADWLESLNLGEHKEAFMDNEIDGSHLPN
LQKEDLIDLGVTRVGHRMNIERALKQLLDR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q80Z38	0.189	0.188	0.000	1476	0.890	0.887	Q80Z38.pdb.gz	SHAN2_MOUSE SH3 and multiple ankyrin repeat domains protein 2 OS=Mus musculus OX=10090 GN=Shank2 PE=1 SV=2
2	AFDB:Q9UPX8	1.000	1.000	0.000	1470	1.000	1.000	Q9UPX8.pdb.gz	SHAN2_HUMAN SH3 and multiple ankyrin repeat domains protein 2 OS=Homo sapiens OX=9606 GN=SHANK2 PE=1 SV=4
3	AFDB:Q9JLU4	0.097	0.085	4.451E-74	1740	0.397	0.336	Q9JLU4.pdb.gz	SHAN3_RAT SH3 and multiple ankyrin repeat domains protein 3 OS=Rattus norvegicus OX=10116 GN=Shank3 PE=1 SV=3
4	AFDB:F1QJ05	0.112	0.109	7.998E-63	1509	0.360	0.351	F1QJ05.pdb.gz
5	AFDB:F1R0Q7	0.092	0.084	3.596E-62	1631	0.353	0.318	F1R0Q7.pdb.gz
6	AFDB:D3YZU1	0.113	0.081	3.819E-62	2167	0.405	0.275	D3YZU1.pdb.gz	SHAN1_MOUSE SH3 and multiple ankyrin repeat domains protein 1 OS=Mus musculus OX=10090 GN=Shank1 PE=1 SV=1
7	AFDB:F1QBX1	0.061	0.069	9.895E-31	1170	0.261	0.327	F1QBX1.pdb.gz
8	AFDB:A1Z9K8	0.075	0.062	1.003E-24	1871	0.175	0.137	A1Z9K8.pdb.gz	A1Z9K8_DROME LD13733p OS=Drosophila melanogaster OX=7227 GN=Prosap PE=2 SV=2
9	AFDB:A0A087X1S9	0.065	0.085	3.966E-10	1069	0.115	0.158	A0A087X1S9.pdb.gz	A0A087X1S9_HUMAN Par-3 family cell polarity regulator beta (Fragment) OS=Homo sapiens OX=9606 GN=PARD3B PE=1 SV=1
10	AFDB:Q9CSB4	0.068	0.082	1.679E-9	1203	0.107	0.131	Q9CSB4.pdb.gz	PAR3L_MOUSE Partitioning defective 3 homolog B OS=Mus musculus OX=10090 GN=Pard3b PE=1 SV=2
11	PDB:7p73A	0.061	0.202	4.234E-7	420	0.016	0.055	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
12	PDB:7pcbA	0.057	0.195	9.825E-7	415	0.024	0.084	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
13	PDB:7pe9I	0.051	0.230	1.304E-5	317	0.019	0.088	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.
14	PDB:2xkxA	0.059	0.116	2.682E-5	721	0.016	0.033	2xkxA.pdb.gz
15	PDB:7p70A	0.054	0.187	2.682E-5	407	0.014	0.052	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
16	PDB:7pc3A	0.056	0.190	2.849E-5	405	0.018	0.064	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
17	PDB:6t36A	0.056	0.781	8.929E-5	93	0.012	0.194	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
18	PDB:7pc5A	0.053	0.182	1.444E-4	405	0.018	0.064	7pc5A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:5n7dA	0.052	0.176	1.951E-4	423	0.016	0.057	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
20	PDB:7qqmA	0.060	0.201	1.951E-4	413	0.014	0.051	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80Z38	0.0	2410	1476	0.890	0.887	SHAN2_MOUSE SH3 and multiple ankyrin repeat domains protein 2 OS=Mus musculus OX=10090 GN=Shank2 PE=1 SV=2
2	Q9QX74	0.0	2409	1474	0.895	0.893	SHAN2_RAT SH3 and multiple ankyrin repeat domains protein 2 OS=Rattus norvegicus OX=10116 GN=Shank2 PE=1 SV=2
3	Q9UPX8	0.0	2950	1849	0.992	0.789	SHAN2_HUMAN SH3 and multiple ankyrin repeat domains protein 2 OS=Homo sapiens OX=9606 GN=SHANK2 PE=1 SV=4
4	D3YZU1	1.82e-140	479	2167	0.271	0.184	SHAN1_MOUSE SH3 and multiple ankyrin repeat domains protein 1 OS=Mus musculus OX=10090 GN=Shank1 PE=1 SV=1
5	H9KV90	1.14e-123	430	2169	0.179	0.121	H9KV90_HUMAN SH3 and multiple ankyrin repeat domains 1 OS=Homo sapiens OX=9606 GN=SHANK1 PE=1 SV=1
6	Q9WV48	4.87e-123	428	2167	0.178	0.121	SHAN1_RAT SH3 and multiple ankyrin repeat domains protein 1 OS=Rattus norvegicus OX=10116 GN=Shank1 PE=1 SV=1
7	Q9Y566	1.25e-122	427	2161	0.181	0.123	SHAN1_HUMAN SH3 and multiple ankyrin repeat domains protein 1 OS=Homo sapiens OX=9606 GN=SHANK1 PE=1 SV=2
8	Q9BYB0	1.16e-111	392	1731	0.177	0.150	SHAN3_HUMAN SH3 and multiple ankyrin repeat domains protein 3 OS=Homo sapiens OX=9606 GN=SHANK3 PE=1 SV=3
9	Q4ACU6	2.11e-111	391	1730	0.176	0.150	SHAN3_MOUSE SH3 and multiple ankyrin repeat domains protein 3 OS=Mus musculus OX=10090 GN=Shank3 PE=1 SV=3
10	Q9JLU4	3.38e-57	221	1740	0.176	0.148	SHAN3_RAT SH3 and multiple ankyrin repeat domains protein 3 OS=Rattus norvegicus OX=10116 GN=Shank3 PE=1 SV=3
11	A0A0B4LF25	9.54e-22	105	1660	0.057	0.051	A0A0B4LF25_DROME Prosap, isoform E OS=Drosophila melanogaster OX=7227 GN=Prosap PE=4 SV=1
12	Q961U4	9.81e-22	105	1478	0.056	0.056	Q961U4_DROME GH06265p OS=Drosophila melanogaster OX=7227 GN=Prosap PE=2 SV=1
13	A0A0B4LFA9	1.01e-21	105	1725	0.057	0.049	A0A0B4LFA9_DROME Prosap, isoform C OS=Drosophila melanogaster OX=7227 GN=Prosap PE=4 SV=1
14	A1Z9K8	1.06e-21	105	1871	0.057	0.045	A1Z9K8_DROME LD13733p OS=Drosophila melanogaster OX=7227 GN=Prosap PE=2 SV=2
15	A0A0B4K7Z0	1.07e-21	105	1806	0.057	0.047	A0A0B4K7Z0_DROME Prosap, isoform D OS=Drosophila melanogaster OX=7227 GN=Prosap PE=4 SV=1
16	B7WN72	5.81e-18	92.8	1140	0.046	0.060	SHANK_CAEEL Protein shank OS=Caenorhabditis elegans OX=6239 GN=shn-1 PE=1 SV=1
17	Q16760	4.20e-12	73.9	1214	0.022	0.027	DGKD_HUMAN Diacylglycerol kinase delta OS=Homo sapiens OX=9606 GN=DGKD PE=1 SV=4
18	E9PUQ8	4.46e-12	73.6	1220	0.022	0.027	DGKD_MOUSE Diacylglycerol kinase delta OS=Mus musculus OX=10090 GN=Dgkd PE=1 SV=1
19	Q86XP1	5.69e-11	70.1	1220	0.020	0.025	DGKH_HUMAN Diacylglycerol kinase eta OS=Homo sapiens OX=9606 GN=DGKH PE=1 SV=1
20	D3YXJ0	9.51e-11	69.3	1211	0.020	0.025	DGKH_MOUSE Diacylglycerol kinase eta OS=Mus musculus OX=10090 GN=Dgkh PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00595 PDZ	9.4e-05	34.0	PDZ domain
2	PF17820 PDZ_6	2.2e-05	35.6	PDZ domain
3	PF02163 Peptidase_M50	55	14.5	Peptidase family M50
4	PF00536 SAM_1	9.3e-17	72.6	SAM domain (Sterile alpha motif)
5	PF07647 SAM_2	1.5e-15	68.4	SAM domain (Sterile alpha motif)
6	PF18017 SAM_4	80	14.7	SAM domain (Sterile alpha motif)
7	PF02198 SAM_PNT	6.4e+02	11.7	Sterile alpha motif (SAM)/Pointed domain
8	PF00018 SH3_1	0.014	26.3	SH3 domain
9	PF07653 SH3_2	5.9e-07	40.5	Variant SH3 domain
10	PF14604 SH3_9	2.8e-05	35.3	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000469689

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382428	0.996	Disks large homolog 4
2	9606.ENSP00000334382	0.980	Homer protein homolog 1
3	9606.ENSP00000316377	0.975	Disks large-associated protein 1
4	9606.ENSP00000365745	0.972	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]
5	9606.ENSP00000400258	0.954	Disks large-associated protein 2
6	9606.ENSP00000362444	0.939	Disks large-associated protein 3
7	9606.ENSP00000305632	0.929	Homer protein homolog 2
8	9606.ENSP00000345502	0.923	cAMP-specific 3',5'-cyclic phosphodiesterase 4D
9	9606.ENSP00000451648	0.918	Neurexin-3
10	9606.ENSP00000385142	0.915	Neurexin-1
11	9606.ENSP00000370485	0.904	Neuroligin-4, X-linked
12	9606.ENSP00000351591	0.899	Neuroligin-3
13	9606.ENSP00000381698	0.892	Sharpin
14	9606.ENSP00000265459	0.884	Neurexin-2
15	9606.ENSP00000293441	0.881	SH3 and multiple ankyrin repeat domains protein 1
16	9606.ENSP00000365272	0.871	Disks large homolog 2
17	9606.ENSP00000363480	0.859	Disks large homolog 3
18	9606.ENSP00000282020	0.846	Glutamate receptor ionotropic, delta-2
19	9606.ENSP00000392500	0.844	Neuroligin-1
20	9606.ENSP00000305288	0.832	Neuroligin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.986	multicellular organismal process
GO:0009987	0.986	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0050877	0.979	nervous system process
GO:0050890	0.964	cognition
GO:0016043	0.936	cellular component organization
GO:0048856	0.935	anatomical structure development
GO:0051703	0.924	biological process involved in intraspecies interaction between organisms
GO:0007275	0.918	multicellular organism development
GO:0048731	0.902	system development
GO:0007399	0.886	nervous system development
GO:0007610	0.849	behavior
GO:0007611	0.843	learning or memory
GO:0048518	0.838	positive regulation of biological process
GO:0010646	0.832	regulation of cell communication
GO:0023051	0.825	regulation of signaling
GO:0034330	0.784	cell junction organization
GO:0048522	0.721	positive regulation of cellular process
GO:0007626	0.661	locomotory behavior
GO:0048519	0.620	negative regulation of biological process
GO:0050896	0.582	response to stimulus
GO:0007612	0.515	learning
GO:0065008	0.510	regulation of biological quality
GO:0030534	0.506	adult behavior
GO:0050808	0.504	synapse organization
GO:0035176	0.499	social behavior
GO:0048523	0.392	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.999	cell periphery
GO:0016020	0.999	membrane
GO:0030054	0.998	cell junction
GO:0005622	0.996	intracellular anatomical structure
GO:0005886	0.993	plasma membrane
GO:0043226	0.991	organelle
GO:0043229	0.952	intracellular organelle
GO:0005737	0.950	cytoplasm
GO:0043227	0.931	membrane-bounded organelle
GO:0045202	0.851	synapse
GO:0042995	0.799	cell projection
GO:0120025	0.757	plasma membrane bounded cell projection
GO:0005829	0.727	cytosol
GO:0043228	0.562	non-membrane-bounded organelle
GO:0098590	0.524	plasma membrane region
GO:0043005	0.487	neuron projection
GO:0036477	0.485	somatodendritic compartment
GO:0098794	0.462	postsynapse
GO:0043232	0.458	intracellular non-membrane-bounded organelle
GO:0005634	0.309	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]