StarFunc result for job id Q9UPY3

User Input

>input (1922 residues)
MKSPALQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNT
IVCLNTGSGKTFIAVLLTKELSYQIRGDFSRNGKRTVFLVNSANQVAQQVSAVRTHSDLK
VGEYSNLEVNASWTKERWNQEFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLA
ILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDL
VVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEALNFINDCNISVHSKERDSTLISK
QILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTFLRKIHALCE
EHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDE
DEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFIT
GHGIGKNQPRNKQMEAEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLP
TEYRSYVQSKGRARAPISNYIMLADTDKIKSFEEDLKTYKAIEKILRNKCSKSVDTGETD
IDPVMDDDDVFPPYVLRPDDGGPRVTINTAIGHINRYCARLPSDPFTHLAPKCRTRELPD
GTFYSTLYLPINSPLRASIVGPPMSCVRLAERVVALICCEKLHKIGELDDHLMPVGKETV
KYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRDSYPRPDQPCYLYVIGMVLTTP
LPDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEVTISIELKKSGFMLSL
QMLELITRLHQYIFSHILRLEKPALEFKPTDADSAYCVLPLNVVNDSSTLDIDFKFMEDI
EKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKF
PSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKR
KAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEELRAQTASDAGV
GVRSLPADFRYPNLDFGWKKSIDSKSFISISNSSSAENDNYCKHSTIVPENAAHQGANRT
SSLENHDQMSVNCRTLLSESPGKLHVEVSADLTAINGLSYNQNLANGSYDLANRDFCQGN
QLNYYKQEIPVQPTTSYSIQNLYSYENQPQPSDECTLLSNKYLDGNANKSTSDGSPVMAV
MPGTTDTIQVLKGRMDSEQSPSIGYSSRTLGPNPGLILQALTLSNASDGFNLERLEMLGD
SFLKHAITTYLFCTYPDAHEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVNW
LPPGYVVNQDKSNTDKWEKDEMTKDCMLANGKLDEDYEEEDEEEESLMWRAPKEEADYED
DFLEYDQEHIRFIDNMLMGSGAFVKKISLSPFSTTDSAYEWKMPKKSSLGSMPFSSDFED
FDYSSWDAMCYLDPSKAVEEDDFVVGFWNPSEENCGVDTGKQSISYDLHTEQCIADKSIA
DCVEALLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTDREKALCPTRENFNSQQKNLSVS
CAAASVASSRSSVLKDSEYGCLKIPPRCMFDHPDADKTLNHLISGFENFEKKINYRFKNK
AYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALV
NNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQGMDSELRRSEEDEEKEE
DIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEM
EPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSLKANQPQVP
NS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5zalA	0.564	0.795	0.000	1314	0.677	0.991	5zalA.pdb.gz	Cryo-EM Structure of Human Dicer and Its Complexes with a Pre-miRNA Substrate.
2	PDB:7yymA	0.598	0.872	0.000	1281	0.643	0.964	7yymA.pdb.gz	Structural and functional basis of mammalian microRNA biogenesis by Dicer.
3	PDB:7yz4A	0.578	0.874	0.000	1234	0.621	0.968	7yz4A.pdb.gz
4	AFDB:Q6TV19	0.438	0.452	0.000	1865	0.785	0.809	Q6TV19.pdb.gz	DICER_DANRE Endoribonuclease Dicer OS=Danio rerio OX=7955 GN=dicer1 PE=2 SV=2
5	AFDB:Q9UPY3	1.000	1.000	0.000	1922	1.000	1.000	Q9UPY3.pdb.gz	DICER_HUMAN Endoribonuclease Dicer OS=Homo sapiens OX=9606 GN=DICER1 PE=1 SV=3
6	PDB:8dg5A	0.657	0.765	7.386E-103	1635	0.351	0.413	8dg5A.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.
7	PDB:8dgaA	0.625	0.730	4.040E-101	1629	0.351	0.414	8dgaA.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.
8	PDB:8dfvA	0.657	0.753	1.268E-100	1664	0.354	0.409	8dfvA.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.
9	PDB:8dgiA	0.605	0.721	5.666E-89	1582	0.339	0.412	8dgiA.pdb.gz
10	AFDB:A1ZAW0	0.438	0.484	5.441E-88	1722	0.230	0.257	A1ZAW0.pdb.gz	DCR2_DROME Endoribonuclease Dcr-2 OS=Drosophila melanogaster OX=7227 GN=Dcr-2 PE=1 SV=1
11	PDB:7v6bA	0.531	0.659	2.150E-75	1496	0.216	0.277	7v6bA.pdb.gz
12	PDB:7v6cA	0.529	0.637	3.057E-75	1540	0.223	0.278	7v6cA.pdb.gz	Structure of the Dicer-2-R2D2 heterodimer bound to a small RNA duplex.
13	PDB:7w0bA	0.555	0.655	1.908E-73	1586	0.225	0.272	7w0bA.pdb.gz	Structural insights into dsRNA processing by Drosophila Dicer-2-Loqs-PD.
14	AFDB:Q8T145	0.156	0.165	1.422E-17	1789	0.130	0.140	Q8T145.pdb.gz	Q8T145_DICDI DNA helicase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274841 PE=3 SV=2
15	AFDB:O75417	0.105	0.083	4.212E-5	2590	0.107	0.080	O75417.pdb.gz	DPOLQ_HUMAN DNA polymerase theta OS=Homo sapiens OX=9606 GN=POLQ PE=1 SV=2
16	AFDB:Q8CGS6	0.108	0.087	1.443E-4	2544	0.106	0.080	Q8CGS6.pdb.gz	DPOLQ_MOUSE DNA polymerase theta OS=Mus musculus OX=10090 GN=Polq PE=1 SV=2
17	AFDB:Q9UNY4	0.130	0.189	1.963E-4	1162	0.041	0.067	Q9UNY4.pdb.gz	TTF2_HUMAN Transcription termination factor 2 OS=Homo sapiens OX=9606 GN=TTF2 PE=1 SV=2
18	AFDB:A0A0G2L9F7	0.118	0.148	1.301E-3	1385	0.044	0.061	A0A0G2L9F7.pdb.gz
19	AFDB:O76743	0.111	0.163	2.870E-3	1156	0.037	0.062	O76743.pdb.gz	GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans OX=6239 GN=glh-4 PE=1 SV=2
20	AFDB:Q54DM3	0.113	0.159	2.999E-3	1259	0.063	0.097	Q54DM3.pdb.gz	Q54DM3_DICDI DNA helicase OS=Dictyostelium discoideum OX=44689 GN=blm PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PU15	0.0	3616	1918	0.935	0.937	E9PU15_RAT Endoribonuclease Dicer OS=Rattus norvegicus OX=10116 GN=Dicer1 PE=3 SV=2
2	P34529	0.0	605	1910	0.201	0.203	DCR1_CAEEL Endoribonuclease dcr-1 OS=Caenorhabditis elegans OX=6239 GN=dcr-1 PE=1 SV=3
3	Q4G034	0.0	757	401	0.198	0.948	Q4G034_RAT Dicer1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Dicer1 PE=2 SV=1
4	Q6TV19	0.0	2967	1865	0.793	0.817	DICER_DANRE Endoribonuclease Dicer OS=Danio rerio OX=7955 GN=dicer1 PE=2 SV=2
5	Q8R418	0.0	3634	1916	0.930	0.933	DICER_MOUSE Endoribonuclease Dicer OS=Mus musculus OX=10090 GN=Dicer1 PE=1 SV=3
6	Q9UPY3	0.0	4002	1922	1.000	1.000	DICER_HUMAN Endoribonuclease Dicer OS=Homo sapiens OX=9606 GN=DICER1 PE=1 SV=3
7	Q9VCU9	1.24e-122	433	2249	0.128	0.109	DCR1_DROME Endoribonuclease Dcr-1 OS=Drosophila melanogaster OX=7227 GN=Dcr-1 PE=1 SV=1
8	Q2Q3V6	7.27e-104	372	1715	0.188	0.211	Q2Q3V6_DROME Dicer-2 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dcr-2 PE=3 SV=1
9	Q2Q3W0	1.02e-103	371	1715	0.188	0.211	Q2Q3W0_DROME Dicer-2 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dcr-2 PE=3 SV=1
10	Q2Q3V5	1.40e-103	371	1715	0.188	0.211	Q2Q3V5_DROME Dicer-2 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dcr-2 PE=3 SV=1
11	Q2Q3V4	1.56e-103	371	1715	0.189	0.212	Q2Q3V4_DROME Dicer-2 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dcr-2 PE=3 SV=1
12	Q2Q3V7	1.57e-103	371	1715	0.189	0.212	Q2Q3V7_DROME Dicer-2 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dcr-2 PE=3 SV=1
13	Q2Q3V9	1.73e-103	371	1715	0.188	0.211	Q2Q3V9_DROME Dicer-2 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dcr-2 PE=3 SV=1
14	A1ZAW0	1.74e-103	371	1722	0.188	0.210	DCR2_DROME Endoribonuclease Dcr-2 OS=Drosophila melanogaster OX=7227 GN=Dcr-2 PE=1 SV=1
15	Q2Q3V8	1.91e-103	370	1715	0.189	0.212	Q2Q3V8_DROME Dicer-2 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dcr-2 PE=3 SV=1
16	Q2Q3W1	2.87e-103	370	1715	0.189	0.212	Q2Q3W1_DROME Dicer-2 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dcr-2 PE=3 SV=1
17	A0A0B4LFK8	3.35e-103	370	1721	0.189	0.212	A0A0B4LFK8_DROME Dicer-2, isoform B OS=Drosophila melanogaster OX=7227 GN=Dcr-2 PE=1 SV=1
18	Q8LMR2	7.51e-67	253	1883	0.117	0.119	DCL1_ORYSJ Endoribonuclease Dicer homolog 1 OS=Oryza sativa subsp. japonica OX=39947 GN=DCL1 PE=3 SV=1
19	A7LFZ6	2.96e-53	209	1657	0.147	0.171	DCL4_ORYSJ Endoribonuclease Dicer homolog 4 OS=Oryza sativa subsp. japonica OX=39947 GN=DCL4 PE=2 SV=1
20	F4HQG6	4.60e-41	169	1910	0.056	0.056	F4HQG6_ARATH Dicer-like 1 OS=Arabidopsis thaliana OX=3702 GN=DCL1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00270 DEAD	3.3e-08	45.0	DEAD/DEAH box helicase
2	PF03368 Dicer_dimer	1.4e-21	87.6	Dicer dimerisation domain
3	PF00035 dsrm	4.5e+02	13.0	Double-stranded RNA binding motif
4	PF00271 Helicase_C	1.4e-14	65.7	Helicase conserved C-terminal domain
5	PF02170 PAZ	2.1e-32	123.4	PAZ domain
6	PF04851 ResIII	2.1e-08	45.9	Type III restriction enzyme, res subunit
7	PF00636 Ribonuclease_3	2.7e-66	232.1	Ribonuclease III domain
8	PF14622 Ribonucleas_3_3	5.7e-21	86.4	Ribonuclease-III-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000437256

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000220592	0.999	Protein argonaute-2
2	9606.ENSP00000266987	0.999	RISC-loading complex subunit TARBP2
3	9606.ENSP00000318176	0.999	Interferon-inducible double-stranded RNA-dependent protein kinase activator A
4	9606.ENSP00000362300	0.999	Protein argonaute-1
5	9606.ENSP00000263209	0.998	Microprocessor complex subunit DGCR8
6	9606.ENSP00000265351	0.998	Exportin-5
7	9606.ENSP00000362287	0.994	Protein argonaute-3
8	9606.ENSP00000357459	0.992	Double-stranded RNA-specific adenosine deaminase
9	9606.ENSP00000362306	0.992	Protein argonaute-4
10	9606.ENSP00000463058	0.989	RNA-binding protein 8A
11	9606.ENSP00000356520	0.987	ATP-dependent RNA helicase A
12	9606.ENSP00000379144	0.987	Trinucleotide repeat-containing gene 6A protein
13	9606.ENSP00000429615	0.986	3'-5' exoribonuclease 1
14	9606.ENSP00000480421	0.985	Serrate RNA effector molecule homolog
15	9606.ENSP00000299001	0.984	Piwi-like protein 4
16	9606.ENSP00000359506	0.979	Synaptic functional regulator FMR1
17	9606.ENSP00000245255	0.978	Piwi-like protein 1
18	9606.ENSP00000352438	0.976	Poly(rC)-binding protein 2
19	9606.ENSP00000478754	0.961	Probable ATP-dependent RNA helicase DDX6
20	9606.ENSP00000425561	0.956	Eukaryotic translation initiation factor 4E

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0016891	0.995	RNA endonuclease activity, producing 5'-phosphomonoesters
GO:0061980	0.971	regulatory RNA binding
GO:0004525	0.896	ribonuclease III activity
GO:0035197	0.755	siRNA binding
GO:0003725	0.425	double-stranded RNA binding
GO:0019904	0.410	protein domain specific binding
GO:0070883	0.385	pre-miRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.989	regulation of biological process
GO:0071704	0.987	organic substance metabolic process
GO:0044238	0.986	primary metabolic process
GO:0044237	0.986	cellular metabolic process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0010468	0.960	regulation of gene expression
GO:0050794	0.958	regulation of cellular process
GO:0006807	0.952	nitrogen compound metabolic process
GO:0043170	0.914	macromolecule metabolic process
GO:0009892	0.912	negative regulation of metabolic process
GO:0050896	0.904	response to stimulus
GO:0010605	0.903	negative regulation of macromolecule metabolic process
GO:0006396	0.892	RNA processing
GO:0010629	0.887	negative regulation of gene expression
GO:0034470	0.843	ncRNA processing
GO:0071840	0.831	cellular component organization or biogenesis
GO:0031047	0.787	RNA-mediated gene silencing
GO:0070918	0.744	regulatory ncRNA processing
GO:0035196	0.724	miRNA processing
GO:0048518	0.703	positive regulation of biological process
GO:0016043	0.660	cellular component organization
GO:0080090	0.488	regulation of primary metabolic process
GO:0010608	0.479	post-transcriptional regulation of gene expression
GO:0009889	0.472	regulation of biosynthetic process
GO:0048522	0.449	positive regulation of cellular process
GO:0031323	0.444	regulation of cellular metabolic process
GO:0051171	0.440	regulation of nitrogen compound metabolic process
GO:0051239	0.432	regulation of multicellular organismal process
GO:0009893	0.398	positive regulation of metabolic process
GO:0019219	0.334	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.318	regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:1990904	0.996	ribonucleoprotein complex
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0043232	0.987	intracellular non-membrane-bounded organelle
GO:0031981	0.969	nuclear lumen
GO:0005654	0.963	nucleoplasm
GO:0031332	0.937	RNAi effector complex
GO:0005576	0.886	extracellular region
GO:0016442	0.859	RISC complex
GO:1902494	0.807	catalytic complex
GO:0031982	0.799	vesicle
GO:0005615	0.784	extracellular space
GO:0012505	0.764	endomembrane system
GO:0016020	0.656	membrane
GO:0140535	0.553	intracellular protein-containing complex
GO:0043230	0.433	extracellular organelle
GO:1905348	0.428	endonuclease complex
GO:0070062	0.416	extracellular exosome
GO:0030054	0.408	cell junction
GO:1902555	0.404	endoribonuclease complex
GO:0044297	0.383	cell body
GO:0070578	0.365	RISC-loading complex
GO:0048471	0.301	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.26.-	0.995	Endoribonucleases producing 5'-phosphomonoesters.
EC:3.1.26.3	0.896	ribonuclease III.

[back to server]