StarFunc result for job id Q9UPY8

User Input

>input (281 residues)
MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRK
VKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYD
GKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAP
PCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEH
ESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5XIT1	0.920	0.920	1.595E-39	281	0.993	0.993	Q5XIT1.pdb.gz	MARE3_RAT Microtubule-associated protein RP/EB family member 3 OS=Rattus norvegicus OX=10116 GN=Mapre3 PE=1 SV=1
2	AFDB:Q15691	0.555	0.580	2.372E-27	268	0.630	0.660	Q15691.pdb.gz	MARE1_HUMAN Microtubule-associated protein RP/EB family member 1 OS=Homo sapiens OX=9606 GN=MAPRE1 PE=1 SV=3
3	AFDB:Q9W6M6	0.586	0.627	6.561E-27	258	0.633	0.690	Q9W6M6.pdb.gz	Q9W6M6_ICTPU EB1 OS=Ictalurus punctatus OX=7998 GN=mapre1b PE=2 SV=1
4	AFDB:Q15555	0.756	0.654	2.114E-26	327	0.591	0.508	Q15555.pdb.gz	MARE2_HUMAN Microtubule-associated protein RP/EB family member 2 OS=Homo sapiens OX=9606 GN=MAPRE2 PE=1 SV=1
5	AFDB:A7MC00	0.798	0.664	6.472E-26	343	0.577	0.472	A7MC00.pdb.gz	A7MC00_DANRE Microtubule-associated protein RP/EB family member 2 OS=Danio rerio OX=7955 GN=mapre2 PE=1 SV=1
6	AFDB:Q7JZD3	0.679	0.659	4.412E-24	291	0.555	0.536	Q7JZD3.pdb.gz	Q7JZD3_DROME Eb1, isoform A OS=Drosophila melanogaster OX=7227 GN=Eb1 PE=1 SV=1
7	AFDB:A1Z6P3	0.620	0.590	4.642E-24	297	0.537	0.508	A1Z6P3.pdb.gz	A1Z6P3_DROME Eb1, isoform F OS=Drosophila melanogaster OX=7227 GN=Eb1 PE=1 SV=2
8	AFDB:Q9GRZ1	0.482	0.429	5.053E-19	316	0.456	0.405	Q9GRZ1.pdb.gz	Q9GRZ1_CAEEL Microtubule End Binding Protein OS=Caenorhabditis elegans OX=6239 GN=ebp-1 PE=1 SV=1
9	PDB:2r8uB	0.462	0.948	5.119E-17	136	0.406	0.838	2r8uB.pdb.gz	Structure of fragment of human end-binding protein 1 (EB1) containing the N-terminal domain at 1.35 A resolution
10	PDB:7sj9M	0.459	0.973	7.689E-17	131	0.466	1.000	7sj9M.pdb.gz	Structural transitions in the GTP cap visualized by cryo-electron microscopy of catalytically inactive microtubules.
11	AFDB:Q7XJ60	0.455	0.463	1.412E-15	276	0.377	0.384	Q7XJ60.pdb.gz	EB1A_ARATH Microtubule-associated protein RP/EB family member 1A OS=Arabidopsis thaliana OX=3702 GN=EB1A PE=1 SV=1
12	AFDB:Q9XXA2	0.473	0.446	1.730E-15	299	0.310	0.291	Q9XXA2.pdb.gz	Q9XXA2_CAEEL Calponin homology domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ebp-2 PE=1 SV=1
13	PDB:7sx8D	0.325	0.212	1.397	448	0.060	0.038	7sx8D.pdb.gz	Structural mechanism for bidirectional actin cross-linking by T-plastin.
14	PDB:7n6g6A	0.270	0.056	1.546	1558	0.093	0.017	7n6g6A.pdb.gz	Cryo-EM structure of an active central apparatus.
15	PDB:7sqcC2	0.297	0.062	2.207	1498	0.096	0.018	7sqcC2.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
16	PDB:5oxpA	0.094	0.067	2.323	462	0.046	0.028	5oxpA.pdb.gz	Multispecific Substrate Recognition in a Proton-Dependent Oligopeptide Transporter.
17	PDB:2rsvA	0.114	0.090	2.571	403	0.064	0.045	2rsvA.pdb.gz
18	PDB:4cniC	0.100	0.141	2.847	171	0.078	0.129	4cniC.pdb.gz
19	PDB:6gzhB	0.094	0.097	2.847	252	0.078	0.087	6gzhB.pdb.gz	Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.
20	PDB:7b93N	0.095	0.083	3.151	345	0.050	0.041	7b93N.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5XIT1	0.0	585	281	0.993	0.993	MARE3_RAT Microtubule-associated protein RP/EB family member 3 OS=Rattus norvegicus OX=10116 GN=Mapre3 PE=1 SV=1
2	Q6PER3	0.0	585	281	0.993	0.993	MARE3_MOUSE Microtubule-associated protein RP/EB family member 3 OS=Mus musculus OX=10090 GN=Mapre3 PE=1 SV=1
3	Q9UPY8	0.0	588	281	1.000	1.000	MARE3_HUMAN Microtubule-associated protein RP/EB family member 3 OS=Homo sapiens OX=9606 GN=MAPRE3 PE=1 SV=1
4	Q9W6M6	1.88e-123	354	258	0.633	0.690	Q9W6M6_ICTPU EB1 OS=Ictalurus punctatus OX=7998 GN=mapre1b PE=2 SV=1
5	Q61166	6.72e-122	350	268	0.630	0.660	MARE1_MOUSE Microtubule-associated protein RP/EB family member 1 OS=Mus musculus OX=10090 GN=Mapre1 PE=1 SV=3
6	Q15691	1.02e-121	350	268	0.633	0.664	MARE1_HUMAN Microtubule-associated protein RP/EB family member 1 OS=Homo sapiens OX=9606 GN=MAPRE1 PE=1 SV=3
7	Q66HR2	2.91e-121	349	268	0.626	0.657	MARE1_RAT Microtubule-associated protein RP/EB family member 1 OS=Rattus norvegicus OX=10116 GN=Mapre1 PE=1 SV=3
8	Q15555	5.94e-116	338	327	0.598	0.514	MARE2_HUMAN Microtubule-associated protein RP/EB family member 2 OS=Homo sapiens OX=9606 GN=MAPRE2 PE=1 SV=1
9	Q8R001	3.06e-114	333	326	0.577	0.497	MARE2_MOUSE Microtubule-associated protein RP/EB family member 2 OS=Mus musculus OX=10090 GN=Mapre2 PE=1 SV=1
10	A7MC00	5.38e-111	326	343	0.587	0.481	A7MC00_DANRE Microtubule-associated protein RP/EB family member 2 OS=Danio rerio OX=7955 GN=mapre2 PE=1 SV=1
11	Q7JZD3	4.45e-104	306	291	0.559	0.540	Q7JZD3_DROME Eb1, isoform A OS=Drosophila melanogaster OX=7227 GN=Eb1 PE=1 SV=1
12	Q9XZ57	1.19e-102	303	290	0.559	0.541	Q9XZ57_DROME Eb1, isoform E OS=Drosophila melanogaster OX=7227 GN=Eb1 PE=1 SV=1
13	A1Z6P3	1.47e-99	295	297	0.544	0.515	A1Z6P3_DROME Eb1, isoform F OS=Drosophila melanogaster OX=7227 GN=Eb1 PE=1 SV=2
14	Q9GRZ1	5.24e-77	238	316	0.452	0.402	Q9GRZ1_CAEEL Microtubule End Binding Protein OS=Caenorhabditis elegans OX=6239 GN=ebp-1 PE=1 SV=1
15	Q9FJJ5	4.28e-57	186	293	0.345	0.331	EB1B_ARATH Microtubule-associated protein RP/EB family member 1B OS=Arabidopsis thaliana OX=3702 GN=EB1B PE=1 SV=1
16	Q7XJ60	1.79e-55	182	276	0.352	0.359	EB1A_ARATH Microtubule-associated protein RP/EB family member 1A OS=Arabidopsis thaliana OX=3702 GN=EB1A PE=1 SV=1
17	Q9FGQ6	2.24e-49	168	329	0.338	0.289	EB1C_ARATH Microtubule-associated protein RP/EB family member 1C OS=Arabidopsis thaliana OX=3702 GN=EB1C PE=1 SV=1
18	Q10113	1.80e-44	154	308	0.349	0.318	MAL3_SCHPO Microtubule integrity protein mal3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mal3 PE=1 SV=1
19	Q9XXA2	1.39e-42	149	299	0.342	0.321	Q9XXA2_CAEEL Calponin homology domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ebp-2 PE=1 SV=1
20	P40013	3.48e-41	147	344	0.335	0.273	BIM1_YEAST Protein BIM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BIM1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11971 CAMSAP_CH	86	14.4	CAMSAP CH domain
2	PF00307 CH	1.1e-12	59.5	Calponin homology (CH) domain
3	PF03271 EB1	1e-14	65.7	EB1-like C-terminal motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000005669

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000008713	0.968	Microtubule-associated protein, RP/EB family, member 1
2	60711.ENSCSAP00000015905	0.884	CAP-GLY domain containing linker protein 1
3	60711.ENSCSAP00000011643	0.870	Dynactin 1
4	60711.ENSCSAP00000006503	0.850	Uncharacterized protein
5	60711.ENSCSAP00000009911	0.847	Platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa)
6	60711.ENSCSAP00000001995	0.840	Cytoskeleton associated protein 5
7	60711.ENSCSAP00000008448	0.804	Centrosomal protein 350kDa
8	60711.ENSCSAP00000018000	0.799	APC2, WNT signaling pathway regulator
9	60711.ENSCSAP00000005031	0.786	Drebrin 1
10	60711.ENSCSAP00000000377	0.764	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family
11	60711.ENSCSAP00000000380	0.764	Centromere protein E, 312kDa
12	60711.ENSCSAP00000007258	0.763	Kinesin-like protein
13	60711.ENSCSAP00000015410	0.749	SRC kinase signaling inhibitor 1
14	60711.ENSCSAP00000016812	0.747	Kinesin-like protein
15	60711.ENSCSAP00000006996	0.738	CAP-GLY domain containing linker protein family, member 4
16	60711.ENSCSAP00000006883	0.724	TBC1 domain family, member 31
17	60711.ENSCSAP00000008237	0.717	Discs, large homolog 4 (Drosophila)
18	60711.ENSCSAP00000003643	0.710	Uncharacterized protein
19	60711.ENSCSAP00000013636	0.697	NDC80 kinetochore complex component
20	60711.ENSCSAP00000014216	0.679	CAP-GLY domain containing linker protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008017	1.000	microtubule binding
GO:0042802	0.801	identical protein binding
GO:0051010	0.730	microtubule plus-end binding
GO:0019899	0.430	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0048518	0.995	positive regulation of biological process
GO:0044093	0.993	positive regulation of molecular function
GO:0048522	0.993	positive regulation of cellular process
GO:0050790	0.989	regulation of catalytic activity
GO:0009987	0.986	cellular process
GO:0031399	0.983	regulation of protein modification process
GO:0042325	0.979	regulation of phosphorylation
GO:0009893	0.976	positive regulation of metabolic process
GO:0045859	0.972	regulation of protein kinase activity
GO:0051173	0.968	positive regulation of nitrogen compound metabolic process
GO:0010604	0.967	positive regulation of macromolecule metabolic process
GO:0031325	0.966	positive regulation of cellular metabolic process
GO:0051347	0.964	positive regulation of transferase activity
GO:0051641	0.959	cellular localization
GO:0042327	0.916	positive regulation of phosphorylation
GO:0045860	0.907	positive regulation of protein kinase activity
GO:0051098	0.881	regulation of binding
GO:0071840	0.872	cellular component organization or biogenesis
GO:0032886	0.871	regulation of microtubule-based process
GO:0016043	0.853	cellular component organization
GO:0051493	0.784	regulation of cytoskeleton organization
GO:0044087	0.766	regulation of cellular component biogenesis
GO:0043254	0.759	regulation of protein-containing complex assembly
GO:1902903	0.714	regulation of supramolecular fiber organization
GO:0033036	0.711	macromolecule localization
GO:0006996	0.624	organelle organization
GO:0070507	0.608	regulation of microtubule cytoskeleton organization
GO:0051099	0.581	positive regulation of binding
GO:0051726	0.554	regulation of cell cycle
GO:0071900	0.546	regulation of protein serine/threonine kinase activity
GO:0007010	0.445	cytoskeleton organization
GO:0007017	0.411	microtubule-based process
GO:0031110	0.403	regulation of microtubule polymerization or depolymerization
GO:0000226	0.395	microtubule cytoskeleton organization
GO:0070727	0.385	cellular macromolecule localization
GO:0008104	0.383	protein localization
GO:0044085	0.340	cellular component biogenesis
GO:0007049	0.320	cell cycle
GO:0032271	0.318	regulation of protein polymerization
GO:0022607	0.315	cellular component assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.995	cytoplasm
GO:0015630	0.995	microtubule cytoskeleton
GO:0099513	0.995	polymeric cytoskeletal fiber
GO:0005874	0.993	microtubule
GO:1990752	0.972	microtubule end
GO:0005819	0.971	spindle
GO:0043227	0.958	membrane-bounded organelle
GO:0005829	0.958	cytosol
GO:0016020	0.924	membrane
GO:0043231	0.917	intracellular membrane-bounded organelle
GO:0005813	0.863	centrosome
GO:0005881	0.818	cytoplasmic microtubule
GO:0071944	0.801	cell periphery
GO:0005876	0.655	spindle microtubule
GO:0005654	0.369	nucleoplasm
GO:0012505	0.346	endomembrane system
GO:0035371	0.345	microtubule plus-end
GO:0005886	0.343	plasma membrane
GO:0120025	0.342	plasma membrane bounded cell projection
GO:0072686	0.313	mitotic spindle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]