StarFunc result for job id Q9UPZ6

User Input

>input (1657 residues)
MGLQARRWASGSRGAAGPRRGVLQLLPLPLPLPLLLLLLLRPGAGRAAAQGEAEAPTLYL
WKTGPWGRCMGDECGPGGIQTRAVWCAHVEGWTTLHTNCKQAERPNNQQNCFKVCDWHKE
LYDWRLGPWNQCQPVISKSLEKPLECIKGEEGIQVREIACIQKDKDIPAEDIICEYFEPK
PLLEQACLIPCQQDCIVSEFSAWSECSKTCGSGLQHRTRHVVAPPQFGGSGCPNLTEFQV
CQSSPCEAEELRYSLHVGPWSTCSMPHSRQVRQARRRGKNKEREKDRSKGVKDPEARELI
KKKRNRNRQNRQENKYWDIQIGYQTREVMCINKTGKAADLSFCQQEKLPMTFQSCVITKE
CQVSEWSEWSPCSKTCHDMVSPAGTRVRTRTIRQFPIGSEKECPEFEEKEPCLSQGDGVV
PCATYGWRTTEWTECRVDPLLSQQDKRRGNQTALCGGGIQTREVYCVQANENLLSQLSTH
KNKEASKPMDLKLCTGPIPNTTQLCHIPCPTECEVSPWSAWGPCTYENCNDQQGKKGFKL
RKRRITNEPTGGSGVTGNCPHLLEAIPCEEPACYDWKAVRLGNCEPDNGKECGPGTQVQE
VVCINSDGEEVDRQLCRDAIFPIPVACDAPCPKDCVLSTWSTWSSCSHTCSGKTTEGKQI
RARSILAYAGEEGGIRCPNSSALQEVRSCNEHPCTVYHWQTGPWGQCIEDTSVSSFNTTT
TWNGEASCSVGMQTRKVICVRVNVGQVGPKKCPESLRPETVRPCLLPCKKDCIVTPYSDW
TSCPSSCKEGDSSIRKQSRHRVIIQLPANGGRDCTDPLYEEKACEAPQACQSYRWKTHKW
RRCQLVPWSVQQDSPGAQEGCGPGRQARAITCRKQDGGQAGIHECLQYAGPVPALTQACQ
IPCQDDCQLTSWSKFSSCNGDCGAVRTRKRTLVGKSKKKEKCKNSHLYPLIETQYCPCDK
YNAQPVGNWSDCILPEGKVEVLLGMKVQGDIKECGQGYRYQAMACYDQNGRLVETSRCNS
HGYIEEACIIPCPSDCKLSEWSNWSRCSKSCGSGVKVRSKWLREKPYNGGRPCPKLDHVN
QAQVYEVVPCHSDCNQYLWVTEPWSICKVTFVNMRENCGEGVQTRKVRCMQNTADGPSEH
VEDYLCDPEEMPLGSRVCKLPCPEDCVISEWGPWTQCVLPCNQSSFRQRSADPIRQPADE
GRSCPNAVEKEPCNLNKNCYHYDYNVTDWSTCQLSEKAVCGNGIKTRMLDCVRSDGKSVD
LKYCEALGLEKNWQMNTSCMVECPVNCQLSDWSPWSECSQTCGLTGKMIRRRTVTQPFQG
DGRPCPSLMDQSKPCPVKPCYRWQYGQWSPCQVQEAQCGEGTRTRNISCVVSDGSADDFS
KVVDEEFCADIELIIDGNKNMVLEESCSQPCPGDCYLKDWSSWSLCQLTCVNGEDLGFGG
IQVRSRPVIIQELENQHLCPEQMLETKSCYDGQCYEYKWMASAWKGSSRTVWCQRSDGIN
VTGGCLVMSQPDADRSCNPPCSQPHSYCSETKTCHCEEGYTEVMSSNSTLEQCTLIPVVV
LPTMEDKRGDVKTSRAVHPTQPSSNPAGRGRTWFLQPFGPDGRLKTWVYGVAAGAFVLLI
FIVSMIYLACKKPKKPQRRQNNRLKPLTLAYDGDADM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A7MBS7	0.563	0.555	0.000	1686	0.695	0.683	A7MBS7.pdb.gz	THS7A_DANRE Thrombospondin type-1 domain-containing protein 7A OS=Danio rerio OX=7955 GN=thsd7aa PE=1 SV=2
2	AFDB:Q9C0I4	0.625	0.642	0.000	1606	0.491	0.507	Q9C0I4.pdb.gz	THS7B_HUMAN Thrombospondin type-1 domain-containing protein 7B OS=Homo sapiens OX=9606 GN=THSD7B PE=1 SV=3
3	AFDB:Q9UPZ6	1.000	1.000	0.000	1657	1.000	1.000	Q9UPZ6.pdb.gz	THS7A_HUMAN Thrombospondin type-1 domain-containing protein 7A OS=Homo sapiens OX=9606 GN=THSD7A PE=1 SV=4
4	AFDB:Q9UKP4	0.050	0.050	7.610E-20	1686	0.122	0.120	Q9UKP4.pdb.gz	ATS7_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Homo sapiens OX=9606 GN=ADAMTS7 PE=1 SV=2
5	AFDB:Q7TSK7	0.062	0.100	6.110E-18	957	0.104	0.180	Q7TSK7.pdb.gz	ATL2_MOUSE ADAMTS-like protein 2 OS=Mus musculus OX=10090 GN=Adamtsl2 PE=1 SV=1
6	AFDB:Q811B3	0.061	0.063	1.933E-17	1600	0.127	0.132	Q811B3.pdb.gz	ATS12_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Mus musculus OX=10090 GN=Adamts12 PE=2 SV=2
7	AFDB:Q86TH1	0.054	0.087	3.010E-17	951	0.106	0.185	Q86TH1.pdb.gz	ATL2_HUMAN ADAMTS-like protein 2 OS=Homo sapiens OX=9606 GN=ADAMTSL2 PE=1 SV=1
8	AFDB:Q3UTY6	0.053	0.071	7.301E-17	1018	0.113	0.185	Q3UTY6.pdb.gz	THSD4_MOUSE Thrombospondin type-1 domain-containing protein 4 OS=Mus musculus OX=10090 GN=Thsd4 PE=1 SV=2
9	AFDB:A2BFS0	0.074	0.131	1.043E-14	766	0.089	0.192	A2BFS0.pdb.gz
10	AFDB:F1S981	0.074	0.137	4.701E-14	807	0.087	0.178	F1S981.pdb.gz
11	PDB:1w0rA	0.053	0.147	8.275E-10	442	0.059	0.219	1w0rA.pdb.gz
12	PDB:7nydE	0.035	0.109	6.662E-5	484	0.043	0.149	7nydE.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
13	PDB:3t5oA	0.051	0.089	1.546E-4	871	0.056	0.107	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
14	PDB:5a42A	0.036	0.037	1.616E-4	1597	0.074	0.077	5a42A.pdb.gz
15	PDB:4e0sB	0.050	0.081	3.587E-4	898	0.067	0.124	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
16	PDB:7nycC	0.051	0.089	6.103E-4	809	0.062	0.126	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
17	PDB:7q1yA	0.039	0.043	3.923E-3	1374	0.052	0.063	7q1yA.pdb.gz
18	PDB:4a5wB	0.051	0.089	4.480E-3	871	0.019	0.037	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.
19	PDB:5oj2B	0.036	0.064	4.895E-3	692	0.039	0.092	5oj2B.pdb.gz
20	PDB:4rtdA	0.031	0.039	6.109E-3	1122	0.043	0.064	4rtdA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A7MBS7	0.0	2382	1686	0.698	0.686	THS7A_DANRE Thrombospondin type-1 domain-containing protein 7A OS=Danio rerio OX=7955 GN=thsd7aa PE=1 SV=2
2	Q69ZU6	0.0	3004	1645	0.902	0.908	THS7A_MOUSE Thrombospondin type-1 domain-containing protein 7A OS=Mus musculus OX=10090 GN=Thsd7a PE=1 SV=2
3	Q9C0I4	0.0	1601	1606	0.491	0.506	THS7B_HUMAN Thrombospondin type-1 domain-containing protein 7B OS=Homo sapiens OX=9606 GN=THSD7B PE=1 SV=3
4	Q9UPZ6	0.0	3395	1657	1.000	1.000	THS7A_HUMAN Thrombospondin type-1 domain-containing protein 7A OS=Homo sapiens OX=9606 GN=THSD7A PE=1 SV=4
5	Q8VCC9	1.18e-20	101	807	0.076	0.156	SPON1_MOUSE Spondin-1 OS=Mus musculus OX=10090 GN=Spon1 PE=1 SV=1
6	F1SFS3	3.15e-20	100	2000	0.133	0.111	F1SFS3_PIG ADAM metallopeptidase with thrombospondin type 1 motif 9 OS=Sus scrofa OX=9823 GN=ADAMTS9 PE=4 SV=5
7	Q9P2N4	4.67e-20	100	1935	0.130	0.111	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
8	E9PUN6	1.23e-19	99.0	1931	0.128	0.110	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
9	E9PYV8	1.72e-19	98.2	1350	0.139	0.171	E9PYV8_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
10	Q9HCB6	2.53e-19	97.1	807	0.058	0.119	SPON1_HUMAN Spondin-1 OS=Homo sapiens OX=9606 GN=SPON1 PE=1 SV=2
11	H0Y859	3.83e-19	97.1	991	0.118	0.198	H0Y859_HUMAN ADAM metallopeptidase with thrombospondin type 1 motif 9 (Fragment) OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=1
12	H2L2A7	1.16e-18	95.9	2165	0.156	0.120	H2L2A7_CAEEL Peptidase M12B domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gon-1 PE=1 SV=1
13	Q19791	1.26e-18	95.5	2150	0.156	0.120	GON1_CAEEL A disintegrin and metalloproteinase with thrombospondin motifs gon-1 OS=Caenorhabditis elegans OX=6239 GN=gon-1 PE=1 SV=3
14	P59510	1.02e-16	89.4	1910	0.134	0.116	ATS20_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Homo sapiens OX=9606 GN=ADAMTS20 PE=2 SV=2
15	O42114	1.69e-16	88.2	803	0.060	0.125	O42114_DANRE Spondin-1 OS=Danio rerio OX=7955 GN=cb1051 PE=2 SV=1
16	F1R2Z9	1.93e-16	87.8	804	0.060	0.124	F1R2Z9_DANRE Spondin-1 OS=Danio rerio OX=7955 GN=F-spondin2 PE=4 SV=3
17	P59511	4.43e-15	84.0	1906	0.136	0.119	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
18	Q96RW7	2.79e-14	81.6	5635	0.058	0.017	HMCN1_HUMAN Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2
19	Q8CDB8	3.72e-14	80.1	701	0.090	0.213	Q8CDB8_MOUSE GON domain-containing protein OS=Mus musculus OX=10090 GN=Adamts9 PE=2 SV=1
20	D3YXG0	7.90e-13	76.6	5634	0.065	0.019	HMCN1_MOUSE Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19030 TSP1_ADAMTS	9.8e-42	152.4	Thrombospondin type 1 domain
2	PF19035 TSP1_CCN	0.00024	32.7	CCN3 Nov like TSP1 domain
3	PF19028 TSP1_spondin	1.5e-103	350.3	Spondin-like TSP1 domain
4	PF00090 TSP_1	2.2e-50	179.9	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000406482

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000283243	0.919	Secretory phospholipase A2 receptor
2	9606.ENSP00000360997	0.918	A disintegrin and metalloproteinase with thrombospondin motifs 13
3	9606.ENSP00000247153	0.914	Properdin
4	9606.ENSP00000347484	0.914	Thrombospondin type-1 domain-containing protein 4
5	9606.ENSP00000460236	0.911	Spondin-1
6	9606.ENSP00000355751	0.910	Thrombospondin-2
7	9606.ENSP00000389588	0.907	Semaphorin-5B
8	9606.ENSP00000272643	0.905	Thrombospondin type-1 domain-containing protein 7B
9	9606.ENSP00000371936	0.905	Semaphorin-5A
10	9606.ENSP00000260356	0.904	Thrombospondin-1
11	9606.ENSP00000418735	0.904	A disintegrin and metalloproteinase with thrombospondin motifs 9
12	9606.ENSP00000483599	0.903	Spondin-2
13	9606.ENSP00000282849	0.902	ADAM metallopeptidase with thrombospondin type 1 motif 18
14	9606.ENSP00000286657	0.902	A disintegrin and metalloproteinase with thrombospondin motifs 3
15	9606.ENSP00000339613	0.902	GDP-fucose protein O-fucosyltransferase 2
16	9606.ENSP00000356975	0.902	A disintegrin and metalloproteinase with thrombospondin motifs 4
17	9606.ENSP00000251582	0.900	A disintegrin and metalloproteinase with thrombospondin motifs 2
18	9606.ENSP00000257359	0.900	A disintegrin and metalloproteinase with thrombospondin motifs 8
19	9606.ENSP00000258613	0.900	Thrombospondin type-1 domain-containing protein 1
20	9606.ENSP00000268070	0.900	ADAM metallopeptidase with thrombospondin type 1 motif 17

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0016787	0.422	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0016043	0.980	cellular component organization
GO:0065007	0.855	biological regulation
GO:0031532	0.855	actin cytoskeleton reorganization
GO:0050789	0.832	regulation of biological process
GO:0050794	0.689	regulation of cellular process
GO:0050896	0.523	response to stimulus
GO:0032502	0.464	developmental process
GO:0008152	0.450	metabolic process
GO:0032501	0.418	multicellular organismal process
GO:0048856	0.385	anatomical structure development
GO:0048583	0.377	regulation of response to stimulus
GO:0071704	0.369	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043227	0.618	membrane-bounded organelle
GO:0043231	0.394	intracellular membrane-bounded organelle
GO:0005737	0.366	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.422	Hydrolases.

[back to server]