StarFunc result for job id Q9UQ03

User Input

>input (480 residues)
MTVTKMSWRPQYRSSKFRNVYGKVANREHCFDGIPITKNVHDNHFCAVNTRFLAIVTESA
GGGSFLVIPLEQTGRIEPNYPKVCGHQGNVLDIKWNPFIDNIIASCSEDTSVRIWEIPEG
GLKRNMTEALLELHGHSRRVGLVEWHPTTNNILFSAGYDYKVLIWNLDVGEPVKMIDCHT
DVILCMSFNTDGSLLTTTCKDKKLRVIEPRSGRVLQEANCKNHRVNRVVFLGNMKRLLTT
GVSRWNTRQIALWDQEDLSMPLIEEEIDGLSGLLFPFYDADTHMLYLAGKGDGNIRYYEI
STEKPYLSYLMEFRSPAPQKGLGVMPKHGLDVSACEVFRFYKLVTLKGLIEPISMIVPRR
SDSYQEDIYPMTPGTEPALTPDEWLGGINRDPVLMSLKEGYKKSSKMVFKAPIKEKKSVV
VNGIDLLENVPPRTENELLRMFFRQQDEIRRLKEELAQKDIRIRQLQLELKNLRNSPKNC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BH44	0.936	0.936	2.948E-97	480	0.981	0.981	Q8BH44.pdb.gz	COR2B_MOUSE Coronin-2B OS=Mus musculus OX=10090 GN=Coro2b PE=1 SV=2
2	AFDB:Q8C0P5	0.817	0.749	2.182E-75	524	0.654	0.599	Q8C0P5.pdb.gz	COR2A_MOUSE Coronin-2A OS=Mus musculus OX=10090 GN=Coro2a PE=2 SV=1
3	AFDB:Q92828	0.814	0.745	2.434E-75	525	0.662	0.606	Q92828.pdb.gz	COR2A_HUMAN Coronin-2A OS=Homo sapiens OX=9606 GN=CORO2A PE=1 SV=2
4	AFDB:Q9ULV4	0.806	0.816	4.407E-58	474	0.435	0.441	Q9ULV4.pdb.gz	COR1C_HUMAN Coronin-1C OS=Homo sapiens OX=9606 GN=CORO1C PE=1 SV=1
5	AFDB:B0R0D7	0.806	0.816	6.829E-58	474	0.423	0.428	B0R0D7.pdb.gz	COR1C_DANRE Coronin-1C-A OS=Danio rerio OX=7955 GN=coro1ca PE=2 SV=1
6	AFDB:A0A0B4KEJ7	0.801	0.720	1.391E-57	535	0.442	0.396	A0A0B4KEJ7.pdb.gz	A0A0B4KEJ7_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=coro PE=1 SV=1
7	AFDB:Q7SX58	0.800	0.843	2.041E-57	455	0.431	0.455	Q7SX58.pdb.gz	Q7SX58_DANRE Coronin OS=Danio rerio OX=7955 GN=fj83g12 PE=1 SV=1
8	AFDB:Q6QEF8	0.798	0.812	2.683E-57	472	0.444	0.451	Q6QEF8.pdb.gz	CORO6_HUMAN Coronin-6 OS=Homo sapiens OX=9606 GN=CORO6 PE=1 SV=2
9	AFDB:Q9BR76	0.798	0.784	6.441E-57	489	0.429	0.421	Q9BR76.pdb.gz	COR1B_HUMAN Coronin-1B OS=Homo sapiens OX=9606 GN=CORO1B PE=1 SV=1
10	AFDB:G8G223	0.799	0.832	9.413E-56	461	0.412	0.430	G8G223.pdb.gz	G8G223_PIG Coronin OS=Sus scrofa OX=9823 GN=coro1a PE=3 SV=1
11	PDB:7styA	0.784	0.962	8.779E-55	390	0.406	0.500	7styA.pdb.gz
12	PDB:2h9lA	0.522	0.750	1.470E-16	321	0.133	0.199	2h9lA.pdb.gz
13	PDB:7ajtUO	0.511	0.499	1.177E-15	493	0.119	0.116	7ajtUO.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
14	PDB:5mzhB	0.478	0.545	1.634E-15	415	0.106	0.123	5mzhB.pdb.gz
15	PDB:5yzgs	0.342	0.419	1.823E-15	374	0.102	0.131	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
16	PDB:5nnzA	0.464	0.640	3.714E-15	335	0.121	0.173	5nnzA.pdb.gz
17	PDB:7mq8LU	0.514	0.551	5.754E-15	445	0.100	0.108	7mq8LU.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:3jcmB	0.522	0.579	1.110E-14	429	0.121	0.135	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
19	PDB:3cfvB	0.502	0.603	1.172E-14	393	0.148	0.181	3cfvB.pdb.gz	Structural Basis for the Recognition of Histone H4 by the Histone-Chaperone RbAp46.
20	PDB:7bt6x	0.476	0.469	1.381E-14	488	0.138	0.135	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BH44	0.0	988	480	0.981	0.981	COR2B_MOUSE Coronin-2B OS=Mus musculus OX=10090 GN=Coro2b PE=1 SV=2
2	Q8C0P5	0.0	672	524	0.660	0.605	COR2A_MOUSE Coronin-2A OS=Mus musculus OX=10090 GN=Coro2a PE=2 SV=1
3	Q92828	0.0	682	525	0.665	0.608	COR2A_HUMAN Coronin-2A OS=Homo sapiens OX=9606 GN=CORO2A PE=1 SV=2
4	Q9UQ03	0.0	998	480	1.000	1.000	COR2B_HUMAN Coronin-2B OS=Homo sapiens OX=9606 GN=CORO2B PE=1 SV=4
5	Q9ULV4	5.53e-145	425	474	0.448	0.454	COR1C_HUMAN Coronin-1C OS=Homo sapiens OX=9606 GN=CORO1C PE=1 SV=1
6	Q6QEF8	2.76e-144	423	472	0.450	0.458	CORO6_HUMAN Coronin-6 OS=Homo sapiens OX=9606 GN=CORO6 PE=1 SV=2
7	Q9WUM4	9.04e-143	419	474	0.448	0.454	COR1C_MOUSE Coronin-1C OS=Mus musculus OX=10090 GN=Coro1c PE=1 SV=2
8	O89053	5.23e-142	417	461	0.442	0.460	COR1A_MOUSE Coronin-1A OS=Mus musculus OX=10090 GN=Coro1a PE=1 SV=5
9	B0R0D7	2.25e-141	416	474	0.440	0.445	COR1C_DANRE Coronin-1C-A OS=Danio rerio OX=7955 GN=coro1ca PE=2 SV=1
10	P31146	4.08e-141	415	461	0.431	0.449	COR1A_HUMAN Coronin-1A OS=Homo sapiens OX=9606 GN=CORO1A PE=1 SV=4
11	Q7SX58	6.36e-141	414	455	0.421	0.444	Q7SX58_DANRE Coronin OS=Danio rerio OX=7955 GN=fj83g12 PE=1 SV=1
12	Q7JVY0	1.26e-140	416	528	0.456	0.415	Q7JVY0_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=coro PE=1 SV=1
13	Q9BR76	4.10e-140	413	489	0.417	0.409	COR1B_HUMAN Coronin-1B OS=Homo sapiens OX=9606 GN=CORO1B PE=1 SV=1
14	Q9WUM3	6.99e-139	410	484	0.410	0.407	COR1B_MOUSE Coronin-1B OS=Mus musculus OX=10090 GN=Coro1b PE=1 SV=1
15	A0A0B4KEU5	1.11e-138	411	534	0.458	0.412	A0A0B4KEU5_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=coro PE=1 SV=1
16	A0A0B4KEJ7	1.39e-138	411	535	0.450	0.404	A0A0B4KEJ7_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=coro PE=1 SV=1
17	O89046	4.88e-138	408	484	0.408	0.405	COR1B_RAT Coronin-1B OS=Rattus norvegicus OX=10116 GN=Coro1b PE=1 SV=1
18	G8G223	6.68e-138	407	461	0.431	0.449	G8G223_PIG Coronin OS=Sus scrofa OX=9823 GN=coro1a PE=3 SV=1
19	P27133	3.34e-120	361	445	0.367	0.396	COROA_DICDI Coronin-A OS=Dictyostelium discoideum OX=44689 GN=corA PE=1 SV=2
20	O13923	1.06e-103	323	601	0.350	0.280	CORO_SCHPO Coronin-like protein crn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=crn1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.00079	31.0	Anaphase-promoting complex subunit 4 WD40 domain
2	PF04977 DivIC	1.2e+02	13.9	Septum formation initiator
3	PF08953 DUF1899	4e-25	98.8	Domain of unknown function (DUF1899)
4	PF20426 NBCH_WD40	0.1	23.0	Neurobeachin beta propeller domain
5	PF00400 WD40	3.9e-10	51.3	WD domain, G-beta repeat
6	PF16300 WD40_4	4.4e-16	69.8	Type of WD40 repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000454783

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000211998	0.958	Vinculin
2	9606.ENSP00000327290	0.823	Integrin alpha-11
3	9606.ENSP00000452871	0.811	Transducin-like enhancer protein 3
4	9606.ENSP00000260363	0.741	Kinesin-like protein KIF23
5	9606.ENSP00000354837	0.591	Rho guanine nucleotide exchange factor 2
6	9606.ENSP00000264993	0.572	CDV3 homolog
7	9606.ENSP00000360660	0.551	Neural proliferation differentiation and control protein 1
8	9606.ENSP00000425556	0.530	Palladin
9	9606.ENSP00000372023	0.527	Serine/threonine-protein kinase Chk2
10	9606.ENSP00000378152	0.527	AKT-interacting protein
11	9606.ENSP00000286353	0.516	2-phosphoxylose phosphatase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008092	1.000	cytoskeletal protein binding
GO:0017166	0.990	vinculin binding
GO:0003779	0.887	actin binding
GO:0044877	0.811	protein-containing complex binding
GO:0051015	0.692	actin filament binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0032970	0.990	regulation of actin filament-based process
GO:0048519	0.940	negative regulation of biological process
GO:0048523	0.915	negative regulation of cellular process
GO:0051128	0.909	regulation of cellular component organization
GO:0071840	0.888	cellular component organization or biogenesis
GO:0016043	0.879	cellular component organization
GO:0032501	0.873	multicellular organismal process
GO:0051493	0.817	regulation of cytoskeleton organization
GO:0010810	0.782	regulation of cell-substrate adhesion
GO:0044087	0.689	regulation of cellular component biogenesis
GO:0032956	0.676	regulation of actin cytoskeleton organization
GO:0048518	0.672	positive regulation of biological process
GO:0032879	0.646	regulation of localization
GO:0098801	0.639	regulation of renal system process
GO:0110053	0.634	regulation of actin filament organization
GO:0065008	0.598	regulation of biological quality
GO:0008015	0.595	blood circulation
GO:0008217	0.530	regulation of blood pressure
GO:0050896	0.521	response to stimulus
GO:0003073	0.520	regulation of systemic arterial blood pressure
GO:0034330	0.495	cell junction organization
GO:0048522	0.468	positive regulation of cellular process
GO:0110020	0.464	regulation of actomyosin structure organization
GO:0150115	0.442	cell-substrate junction organization
GO:0022607	0.397	cellular component assembly
GO:0051129	0.366	negative regulation of cellular component organization
GO:0006996	0.340	organelle organization
GO:0048856	0.332	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070161	0.995	anchoring junction
GO:0030055	0.986	cell-substrate junction
GO:0005925	0.952	focal adhesion
GO:0005622	0.847	intracellular anatomical structure
GO:0005737	0.843	cytoplasm
GO:0043226	0.841	organelle
GO:0043227	0.831	membrane-bounded organelle
GO:0043229	0.803	intracellular organelle
GO:0016020	0.710	membrane
GO:0043231	0.528	intracellular membrane-bounded organelle
GO:0043232	0.416	intracellular non-membrane-bounded organelle
GO:0031982	0.326	vesicle
GO:0071944	0.305	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]