StarFunc result for job id Q9UQ05

User Input

>input (1017 residues)
MPVMKGLLAPQNTFLDTIATRFDGTHSNFLLANAQGTRGFPIVYCSDGFCELTGYGRTEV
MQKTCSCRFLYGPETSEPALQRLHKALEGHQEHRAEICFYRKDGSAFWCLLDMMPIKNEM
GEVVLFLFSFKDITQSGSPGLGPQGGRGDSNHENSLGRRGATWKFRSARRRSRTVLHRLT
GHFGRRGQGGMKANNNVFEPKPSVPEYKVASVGGSRCLLLHYSVSKAIWDGLILLATFYV
AVTVPYNVCFSGDDDTPITSRHTLVSDIAVEMLFILDIILNFRTTYVSQSGQVISAPRSI
GLHYLATWFFIDLIAALPFDLLYIFNITVTSLVHLLKTVRLLRLLRLLQKLERYSQCSAV
VLTLLMSVFALLAHWMACIWYVIGRREMEANDPLLWDIGWLHELGKRLEVPYVNGSVGGP
SRRSAYIAALYFTLSSLTSVGFGNVCANTDAEKIFSICTMLIGALMHAVVFGNVTAIIQR
MYSRRSLYHSRMKDLKDFIRVHRLPRPLKQRMLEYFQTTWAVNSGIDANELLRDFPDELR
ADIAMHLNREILQLPLFGAASRGCLRALSLHIKTSFCAPGEYLLRRGDALQAHYYVCSGS
LEVLRDNMVLAILGKGDLIGADIPEPGQEPGLGADPNFVLKTSADVKALTYCGLQQLSSR
GLAEVLRLYPEYGAAFRAGLPRDLTFNLRQGSDTSGLSRFSRSPRLSQPRSESLGSSSDK
TLPSITEAESGAEPGGGPRPRRPLLLPNLSPARPRGSLVSLLGEELPPFSALVSSPSLSP
SLSPALAGQGHSASPHGPPRCSAAWKPPQLLIPPLGTFGPPDLSPRIVDGIEDSGSTAEA
PSFRFSRRPELPRPRSQAPPTGTRPSPELASEAEEVKEKVCRLNQEISRLNQEVSQLSRE
LRHIMGLLQARLGPPGHPAGSAWTPDPPCPQLRPPCLSPCASRPPPSLQDTTLAEVHCPA
SVGTMETGTALLDLRPSILPPYPSEPDPLGPSPVPEASPPTPSLLRHSFQSRSDTFH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UQ05	0.999	0.999	0.000	1017	1.000	1.000	Q9UQ05.pdb.gz	KCNH4_HUMAN Potassium voltage-gated channel subfamily H member 4 OS=Homo sapiens OX=9606 GN=KCNH4 PE=2 SV=1
2	AFDB:Q96L42	0.642	0.591	2.810E-100	1107	0.567	0.521	Q96L42.pdb.gz	KCNH8_HUMAN Potassium voltage-gated channel subfamily H member 8 OS=Homo sapiens OX=9606 GN=KCNH8 PE=2 SV=2
3	AFDB:A8WHX9	0.634	0.703	1.427E-91	914	0.522	0.581	A8WHX9.pdb.gz	A8WHX9_DANRE Potassium voltage-gated channel, subfamily H (eag-related), member 3 (Fragment) OS=Danio rerio OX=7955 GN=kcnh3 PE=1 SV=1
4	AFDB:Q9ULD8	0.680	0.641	2.142E-89	1083	0.508	0.477	Q9ULD8.pdb.gz	KCNH3_HUMAN Potassium voltage-gated channel subfamily H member 3 OS=Homo sapiens OX=9606 GN=KCNH3 PE=1 SV=2
5	AFDB:O44164	0.579	0.614	6.801E-65	956	0.307	0.326	O44164.pdb.gz	O44164_CAEEL Potassium voltage-gated channel protein eag OS=Caenorhabditis elegans OX=6239 GN=egl-2 PE=4 SV=2
6	AFDB:Q7JPB9	0.438	0.517	1.385E-46	855	0.240	0.285	Q7JPB9.pdb.gz	Q7JPB9_DROME GH12235p OS=Drosophila melanogaster OX=7227 GN=sei PE=2 SV=1
7	PDB:7rhsA	0.385	0.815	1.263E-27	456	0.110	0.246	7rhsA.pdb.gz
8	PDB:7n15A	0.377	0.693	1.098E-24	520	0.106	0.208	7n15A.pdb.gz	Structural and functional characterization of an achromatopsia-associated mutation in a phototransduction channel.
9	AFDB:Q9LDR2	0.399	0.545	1.937E-24	729	0.109	0.152	Q9LDR2.pdb.gz	CNG19_ARATH Putative cyclic nucleotide-gated ion channel 19 OS=Arabidopsis thaliana OX=3702 GN=CNGC19 PE=3 SV=1
10	PDB:7rhsD	0.374	0.803	1.245E-23	441	0.085	0.195	7rhsD.pdb.gz
11	PDB:7o4hB	0.377	0.764	3.577E-22	468	0.108	0.235	7o4hB.pdb.gz
12	PDB:7wswA	0.336	0.656	4.877E-22	472	0.096	0.208	7wswA.pdb.gz
13	PDB:7calA	0.361	0.775	4.271E-21	444	0.095	0.218	7calA.pdb.gz
14	PDB:7xufA	0.350	0.676	6.132E-21	476	0.098	0.210	7xufA.pdb.gz
15	PDB:7o4hD	0.276	0.663	1.108E-12	383	0.077	0.204	7o4hD.pdb.gz
16	PDB:2wkpA	0.107	0.325	4.093E-9	320	0.034	0.109	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
17	PDB:6eo1A	0.127	0.274	1.117E-7	355	0.072	0.206	6eo1A.pdb.gz
18	AFDB:Q8IY17	0.112	0.085	1.818E-6	1375	0.083	0.061	Q8IY17.pdb.gz	PLPL6_HUMAN Patatin-like phospholipase domain-containing protein 6 OS=Homo sapiens OX=9606 GN=PNPLA6 PE=1 SV=3
19	AFDB:Q8C419	0.071	0.063	3.355E-4	1200	0.118	0.100	Q8C419.pdb.gz	MGLYR_MOUSE Metabotropic glycine receptor OS=Mus musculus OX=10090 GN=Gpr158 PE=1 SV=2
20	AFDB:A0A0R4IF44	0.078	0.053	3.258E-3	1792	0.141	0.080	A0A0R4IF44.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8WHX9	0.0	874	914	0.500	0.557	A8WHX9_DANRE Potassium voltage-gated channel, subfamily H (eag-related), member 3 (Fragment) OS=Danio rerio OX=7955 GN=kcnh3 PE=1 SV=1
2	O54853	0.0	613	950	0.344	0.368	KCNH6_RAT Potassium voltage-gated channel subfamily H member 6 OS=Rattus norvegicus OX=10116 GN=Kcnh6 PE=1 SV=1
3	Q96L42	0.0	1061	1107	0.578	0.531	KCNH8_HUMAN Potassium voltage-gated channel subfamily H member 8 OS=Homo sapiens OX=9606 GN=KCNH8 PE=2 SV=2
4	Q9H252	0.0	603	994	0.326	0.334	KCNH6_HUMAN Potassium voltage-gated channel subfamily H member 6 OS=Homo sapiens OX=9606 GN=KCNH6 PE=1 SV=1
5	Q9QWS8	0.0	1056	1102	0.584	0.539	KCNH8_RAT Potassium voltage-gated channel subfamily H member 8 OS=Rattus norvegicus OX=10116 GN=Kcnh8 PE=2 SV=2
6	Q9ULD8	0.0	861	1083	0.511	0.480	KCNH3_HUMAN Potassium voltage-gated channel subfamily H member 3 OS=Homo sapiens OX=9606 GN=KCNH3 PE=1 SV=2
7	Q9UQ05	0.0	2070	1017	1.000	1.000	KCNH4_HUMAN Potassium voltage-gated channel subfamily H member 4 OS=Homo sapiens OX=9606 GN=KCNH4 PE=2 SV=1
8	Q63472	2.68e-172	531	962	0.343	0.363	KCNH1_RAT Potassium voltage-gated channel subfamily H member 1 OS=Rattus norvegicus OX=10116 GN=Kcnh1 PE=1 SV=1
9	O18965	5.80e-167	518	987	0.283	0.292	KCNH1_BOVIN Potassium voltage-gated channel subfamily H member 1 OS=Bos taurus OX=9913 GN=KCNH1 PE=2 SV=2
10	O95259	1.11e-166	517	989	0.280	0.288	KCNH1_HUMAN Potassium voltage-gated channel subfamily H member 1 OS=Homo sapiens OX=9606 GN=KCNH1 PE=1 SV=1
11	K4EHU2	2.36e-166	515	956	0.276	0.294	K4EHU2_DANRE Potassium voltage-gated channel subfamily H member 1b OS=Danio rerio OX=7955 GN=Eag1 PE=2 SV=1
12	Q60603	2.70e-166	516	989	0.280	0.288	KCNH1_MOUSE Potassium voltage-gated channel subfamily H member 1 OS=Mus musculus OX=10090 GN=Kcnh1 PE=1 SV=2
13	Q9EPI9	3.98e-166	515	988	0.280	0.288	KCNH5_RAT Potassium voltage-gated channel subfamily H member 5 OS=Rattus norvegicus OX=10116 GN=Kcnh5 PE=2 SV=1
14	Q8NCM2	4.47e-166	515	988	0.280	0.288	KCNH5_HUMAN Potassium voltage-gated channel subfamily H member 5 OS=Homo sapiens OX=9606 GN=KCNH5 PE=1 SV=3
15	Q02280	1.36e-164	516	1174	0.280	0.243	KCNAE_DROME Potassium voltage-gated channel protein eag OS=Drosophila melanogaster OX=7227 GN=eag PE=1 SV=2
16	Q108P3	6.99e-164	508	959	0.276	0.293	Q108P3_DANRE Potassium voltage-gated channel subfamily H member 1 OS=Danio rerio OX=7955 GN=Eag1 PE=2 SV=1
17	O44164	6.46e-155	485	956	0.268	0.286	O44164_CAEEL Potassium voltage-gated channel protein eag OS=Caenorhabditis elegans OX=6239 GN=egl-2 PE=4 SV=2
18	Q12809	1.05e-148	474	1159	0.255	0.223	KCNH2_HUMAN Potassium voltage-gated channel subfamily H member 2 OS=Homo sapiens OX=9606 GN=KCNH2 PE=1 SV=1
19	O08962	1.32e-148	474	1163	0.241	0.211	KCNH2_RAT Potassium voltage-gated channel subfamily H member 2 OS=Rattus norvegicus OX=10116 GN=Kcnh2 PE=1 SV=1
20	Q9NS40	1.38e-148	475	1196	0.245	0.208	KCNH7_HUMAN Potassium voltage-gated channel subfamily H member 7 OS=Homo sapiens OX=9606 GN=KCNH7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10473 CENP-F_leu_zip	2.2e+02	13.3	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
2	PF16526 CLZ	5e+02	12.5	C-terminal leucine zipper domain of cyclic nucleotide-gated channels
3	PF00027 cNMP_binding	0.11	24.0	Cyclic nucleotide-binding domain
4	PF00520 Ion_trans	5.9e-27	106.0	Ion transport protein
5	PF07885 Ion_trans_2	2.6e-07	41.8	Ion channel
6	PF01486 K-box	1.4e+02	14.1	K-box region
7	PF00989 PAS	0.0054	28.1	PAS fold
8	PF08447 PAS_3	9.4e-06	37.2	PAS fold
9	PF08448 PAS_4	0.0076	27.9	PAS fold
10	PF13426 PAS_9	1.2e-15	69.1	PAS domain
11	PF04102 SlyX	5.3e+02	12.7	SlyX
12	PF14377 UBM	1.7e+02	13.1	Ubiquitin binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264661

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000295082	0.816	Potassium voltage-gated channel subfamily F member 1
2	9606.ENSP00000302719	0.782	Voltage-gated potassium channel subunit beta-3
3	9606.ENSP00000287042	0.779	Potassium voltage-gated channel subfamily S member 2
4	9606.ENSP00000373648	0.758	Potassium voltage-gated channel subfamily KQT member 3
5	9606.ENSP00000434241	0.750	Potassium voltage-gated channel subfamily C member 3
6	9606.ENSP00000262916	0.739	Potassium voltage-gated channel subfamily KQT member 4
7	9606.ENSP00000419952	0.729	Voltage-gated potassium channel subunit beta-1
8	9606.ENSP00000367323	0.712	Voltage-gated potassium channel subunit beta-2
9	9606.ENSP00000430846	0.712	Potassium voltage-gated channel subfamily B member 2
10	9606.ENSP00000265969	0.705	Potassium voltage-gated channel subfamily C member 1
11	9606.ENSP00000358786	0.704	Potassium voltage-gated channel subfamily A member 10
12	9606.ENSP00000304127	0.703	Potassium voltage-gated channel subfamily G member 3
13	9606.ENSP00000218176	0.702	Potassium voltage-gated channel subfamily D member 1
14	9606.ENSP00000360806	0.702	Potassium voltage-gated channel subfamily B member 1
15	9606.ENSP00000358802	0.699	Potassium voltage-gated channel subfamily C member 4
16	9606.ENSP00000352035	0.685	Potassium voltage-gated channel subfamily KQT member 2
17	9606.ENSP00000312129	0.682	Potassium voltage-gated channel subfamily G member 4
18	9606.ENSP00000307694	0.668	Potassium voltage-gated channel subfamily S member 1
19	9606.ENSP00000221444	0.665	Potassium voltage-gated channel subfamily A member 7
20	9606.ENSP00000435954	0.665	Potassium voltage-gated channel subfamily V member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005249	1.000	voltage-gated potassium channel activity
GO:0005488	0.985	binding
GO:0005515	0.980	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006811	0.993	monoatomic ion transport
GO:0006813	0.981	potassium ion transport
GO:0009987	0.554	cellular process
GO:0055085	0.438	transmembrane transport
GO:0065007	0.375	biological regulation
GO:0050789	0.325	regulation of biological process
GO:0034220	0.303	monoatomic ion transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.974	protein-containing complex
GO:1990351	0.905	transporter complex
GO:0008076	0.902	voltage-gated potassium channel complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	1.000	K(+)(in) = K(+)(out)

[back to server]