StarFunc result for job id Q9UQ26

User Input

>input (1411 residues)
MSAPVGPRGRLAPIPAASQPPLQPEMPDLSHLTEEERKIILAVMDRQKKKVKEEHKPQLT
QWFPFSGITELVNNVLQPQQKQQNEKEPQTKLHQQFEMYKEQVKKMGEESQQQQEQKGDA
PTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNKVMWVCNLCRKQQEILTKSGA
WFYNSGSNTPQQPDQKVLRGLRNEEAPQEKKPKLHEQTQFQGPSGDLSVPAVEKSRSHGL
TRQHSIKNGSGVKHHIASDIASDRKRSPSVSRDQNRRYDQREEREEYSQYATSDTAMPRS
PSDYADRRSQHEPQFYEDSDHLSYRDSNRRSHRHSKEYIVDDEDVESRDEYERQRREEEY
QSRYRSDPNLARYPVKPQPYEEQMRIHAEVSRARHERRHSDVSLANADLEDSRISMLRMD
RPSRQRSISERRAAMENQRSYSMERTREAQGPSSYAQRTTNHSPPTPRRSPLPIDRPDLR
RTDSLRKQHHLDPSSAVRKTKREKMETMLRNDSLSSDQSESVRPPPPKPHKSKKGGKMRQ
ISLSSSEEELASTPEYTSCDDVEIESESVSEKGDSQKGKRKTSEQAVLSDSNTRSERQKE
MMYFGGHSLEEDLEWSEPQIKDSGVDTCSSTTLNEEHSHSDKHPVTWQPSKDGDRLIGRI
LLNKRLKDGSVPRDSGAMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVL
EWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDIPRIPDSTHAQLESSSSSFESQ
KMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWFDKVGHQLIVTILGAKDLPSREDGRP
RNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQAR
VREEESEFLGEILIELETALLDDEPHWYKLQTHDVSSLPLPHPSPYMPRRQLHGESPTRR
LQRSKRISDSEVSDYDCDDGIGVVSDYRHDGRDLQSSTLSVPEQVMSSNHCSPSGSPHRV
DVIGRTRSWSPSVPPPQSRNVEQGLRGTRTMTGHYNTISRMDRHRVMDDHYSPDRDRDCE
AADRQPYHRSRSTEQRPLLERTTTRSRSTERPDTNLMRSMPSLMTGRSAPPSPALSRSHP
RTGSVQTSPSSTPVAGRRGRQLPQLPPKGTLDRKAGGKKLRSTVQRSTETGLAVEMRNWM
TRQASRESTDGSMNSYSSEGNLIFPGVRLASDSQFSDFLDGLGPAQLVGRQTLATPAMGD
IQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKVARKTLE
PLYQQLLSFEESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLFPP
SSLVDPTLAPLTRRASQSSLESSTGPSYSRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86UR5	0.287	0.247	0.000	1692	0.605	0.504	Q86UR5.pdb.gz	RIMS1_HUMAN Regulating synaptic membrane exocytosis protein 1 OS=Homo sapiens OX=9606 GN=RIMS1 PE=1 SV=1
2	AFDB:Q9EQZ7	0.195	0.183	0.000	1530	0.904	0.833	Q9EQZ7.pdb.gz	RIMS2_MOUSE Regulating synaptic membrane exocytosis protein 2 OS=Mus musculus OX=10090 GN=Rims2 PE=1 SV=1
3	AFDB:Q9JIR4	0.266	0.238	0.000	1615	0.594	0.519	Q9JIR4.pdb.gz	RIMS1_RAT Regulating synaptic membrane exocytosis protein 1 OS=Rattus norvegicus OX=10116 GN=Rims1 PE=1 SV=1
4	AFDB:Q9UQ26	1.000	1.000	0.000	1411	1.000	1.000	Q9UQ26.pdb.gz	RIMS2_HUMAN Regulating synaptic membrane exocytosis protein 2 OS=Homo sapiens OX=9606 GN=RIMS2 PE=1 SV=2
5	AFDB:Q22366	0.166	0.153	1.015E-67	1563	0.265	0.239	Q22366.pdb.gz	RIM_CAEEL Rab-3-interacting molecule unc-10 OS=Caenorhabditis elegans OX=6239 GN=unc-10 PE=2 SV=2
6	AFDB:P60191	0.114	0.570	1.901E-30	269	0.112	0.587	P60191.pdb.gz	RIMS4_MOUSE Regulating synaptic membrane exocytosis protein 4 OS=Mus musculus OX=10090 GN=Rims4 PE=1 SV=1
7	AFDB:B7Z0K1	0.094	0.113	6.707E-14	1137	0.123	0.153	B7Z0K1.pdb.gz	B7Z0K1_DROME Bitesize, isoform H OS=Drosophila melanogaster OX=7227 GN=btsz PE=4 SV=1
8	AFDB:Q6XK20	0.095	0.121	6.707E-14	1102	0.132	0.169	Q6XK20.pdb.gz	Q6XK20_DROME Bitesize isoform 1 OS=Drosophila melanogaster OX=7227 GN=btsz PE=2 SV=1
9	PDB:3pfqA	0.084	0.218	9.943E-11	523	0.026	0.071	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
10	AFDB:Q9W283	0.071	0.075	1.687E-8	1329	0.140	0.148	Q9W283.pdb.gz	Q9W283_DROME Arc, isoform A OS=Drosophila melanogaster OX=7227 GN=a PE=2 SV=2
11	PDB:5ixcA	0.063	0.127	6.279E-6	684	0.017	0.035	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
12	AFDB:P27715	0.059	0.041	1.103E-5	2155	0.118	0.077	P27715.pdb.gz	UNC13_CAEEL Phorbol ester/diacylglycerol-binding protein unc-13 OS=Caenorhabditis elegans OX=6239 GN=unc-13 PE=1 SV=4
13	PDB:1cjyA	0.060	0.129	1.470E-5	633	0.019	0.043	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
14	PDB:5izrC	0.057	0.119	1.818E-5	659	0.016	0.035	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
15	PDB:5iz5B	0.062	0.117	3.825E-5	746	0.017	0.032	5iz5B.pdb.gz
16	PDB:4rj9A	0.054	0.427	6.507E-5	161	0.016	0.137	4rj9A.pdb.gz
17	PDB:5a52A	0.054	0.444	7.632E-5	154	0.015	0.136	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
18	PDB:5a50A	0.056	0.435	8.048E-5	165	0.015	0.127	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
19	PDB:7p73A	0.061	0.190	8.951E-5	420	0.017	0.057	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
20	PDB:7pc3A	0.058	0.193	1.986E-4	405	0.020	0.069	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86UR5	0.0	1041	1692	0.432	0.361	RIMS1_HUMAN Regulating synaptic membrane exocytosis protein 1 OS=Homo sapiens OX=9606 GN=RIMS1 PE=1 SV=1
2	Q99NE5	0.0	632	1463	0.256	0.247	RIMS1_MOUSE Regulating synaptic membrane exocytosis protein 1 OS=Mus musculus OX=10090 GN=Rims1 PE=1 SV=2
3	Q9EQZ7	0.0	2014	1530	0.736	0.679	RIMS2_MOUSE Regulating synaptic membrane exocytosis protein 2 OS=Mus musculus OX=10090 GN=Rims2 PE=1 SV=1
4	Q9JIR4	0.0	960	1615	0.422	0.369	RIMS1_RAT Regulating synaptic membrane exocytosis protein 1 OS=Rattus norvegicus OX=10116 GN=Rims1 PE=1 SV=1
5	Q9JIS1	0.0	1932	1555	0.724	0.657	RIMS2_RAT Regulating synaptic membrane exocytosis protein 2 OS=Rattus norvegicus OX=10116 GN=Rims2 PE=1 SV=1
6	Q9UQ26	0.0	2905	1411	1.000	1.000	RIMS2_HUMAN Regulating synaptic membrane exocytosis protein 2 OS=Homo sapiens OX=9606 GN=RIMS2 PE=1 SV=2
7	Q9UJD0	5.19e-106	340	308	0.123	0.562	RIMS3_HUMAN Regulating synaptic membrane exocytosis protein 3 OS=Homo sapiens OX=9606 GN=RIMS3 PE=1 SV=1
8	Q80U57	1.80e-103	333	307	0.124	0.570	RIMS3_MOUSE Regulating synaptic membrane exocytosis protein 3 OS=Mus musculus OX=10090 GN=Rims3 PE=1 SV=2
9	Q9JIR3	3.86e-103	333	307	0.123	0.567	RIMS3_RAT Regulating synaptic membrane exocytosis protein 3 OS=Rattus norvegicus OX=10116 GN=Rims3 PE=1 SV=1
10	P60191	3.98e-99	320	269	0.112	0.587	RIMS4_MOUSE Regulating synaptic membrane exocytosis protein 4 OS=Mus musculus OX=10090 GN=Rims4 PE=1 SV=1
11	Q9H426	4.06e-99	320	269	0.113	0.591	RIMS4_HUMAN Regulating synaptic membrane exocytosis protein 4 OS=Homo sapiens OX=9606 GN=RIMS4 PE=1 SV=3
12	Q8CIX1	3.29e-98	317	269	0.111	0.580	RIMS4_RAT Regulating synaptic membrane exocytosis protein 4 OS=Rattus norvegicus OX=10116 GN=Rims4 PE=1 SV=1
13	A0A0B4K742	5.65e-55	214	2595	0.074	0.040	A0A0B4K742_DROME Rab3 interacting molecule, isoform W OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1
14	A0A0B4K7E1	5.72e-55	214	1955	0.074	0.054	A0A0B4K7E1_DROME Rab3 interacting molecule, isoform U OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1
15	A0A0B4K679	6.26e-55	214	1965	0.074	0.053	A0A0B4K679_DROME Rab3 interacting molecule, isoform V OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1
16	A0A0B4K6B7	9.89e-55	213	1655	0.074	0.063	A0A0B4K6B7_DROME Rab3 interacting molecule, isoform Z OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1
17	A0A0B4K6M2	1.17e-54	213	2798	0.074	0.038	A0A0B4K6M2_DROME Rab3 interacting molecule, isoform F OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1
18	A0A0B4K7F3	2.15e-53	208	1399	0.067	0.068	A0A0B4K7F3_DROME Rab3 interacting molecule, isoform S OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1
19	A0A0B4KG75	2.18e-53	208	1358	0.067	0.070	A0A0B4KG75_DROME Rab3 interacting molecule, isoform AA OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=1
20	Q9VEE5	4.86e-53	207	1931	0.067	0.049	Q9VEE5_DROME Rab3 interacting molecule, isoform Q OS=Drosophila melanogaster OX=7227 GN=Rim PE=4 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	7.1e-34	127.5	C2 domain
2	PF02318 FYVE_2	8.1e-07	40.6	FYVE-type zinc finger
3	PF01485 IBR	5.4e+02	12.1	IBR domain, a half RING-finger domain
4	PF00595 PDZ	0.021	26.5	PDZ domain
5	PF17820 PDZ_6	0.0021	29.2	PDZ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9544.ENSMMUP00000025503

Rank	PPI partner	STRING score	Description
1	9544.ENSMMUP00000011860	0.974	RIMS binding protein 2
2	9544.ENSMMUP00000023769	0.974	TSPO associated protein 1
3	9544.ENSMMUP00000020302	0.964	Unc-13 homolog A (C. elegans)
4	9544.ENSMMUP00000021473	0.961	Uncharacterized protein
5	9544.ENSMMUP00000006653	0.934	RAB3A, member RAS oncogene family
6	9544.ENSMMUP00000006854	0.931	RAB3C, member RAS oncogene family
7	9544.ENSMMUP00000014842	0.931	RAB3D, member RAS oncogene family
8	9544.ENSMMUP00000018446	0.931	RAB3B, member RAS oncogene family
9	9544.ENSMMUP00000019712	0.929	Unc-13 homolog B (C. elegans)
10	9544.ENSMMUP00000019713	0.929	Unc-13 homolog C (C. elegans)
11	9544.ENSMMUP00000028475	0.914	ELKS/RAB6-interacting/CAST family member 2
12	9544.ENSMMUP00000016275	0.880	Unc-79 homolog, NALCN channel complex subunit
13	9544.ENSMMUP00000027368	0.848	Rap guanine nucleotide exchange factor (GEF) 4
14	9544.ENSMMUP00000014337	0.825	ELKS/RAB6-interacting/CAST family member 1
15	9544.ENSMMUP00000014487	0.808	Synaptosomal-associated protein 25
16	9544.ENSMMUP00000000081	0.801	PTPRF interacting protein alpha 4
17	9544.ENSMMUP00000009886	0.801	Protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 3
18	9544.ENSMMUP00000017449	0.801	PTPRF interacting protein alpha 1
19	9544.ENSMMUP00000018153	0.801	Liprin-alpha-2 isoform a
20	9544.ENSMMUP00000030372	0.801	Kazrin, periplakin interacting protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.977	regulation of cellular process
GO:0009987	0.973	cellular process
GO:0051179	0.928	localization
GO:0051234	0.907	establishment of localization
GO:0006810	0.903	transport
GO:0006887	0.890	exocytosis
GO:0048518	0.784	positive regulation of biological process
GO:0051128	0.779	regulation of cellular component organization
GO:0048522	0.742	positive regulation of cellular process
GO:0022603	0.670	regulation of anatomical structure morphogenesis
GO:0040008	0.645	regulation of growth
GO:0022604	0.619	regulation of cell morphogenesis
GO:1903859	0.593	regulation of dendrite extension
GO:0051239	0.531	regulation of multicellular organismal process
GO:0051094	0.431	positive regulation of developmental process
GO:0045055	0.429	regulated exocytosis
GO:0032879	0.424	regulation of localization
GO:0017156	0.401	calcium-ion regulated exocytosis
GO:0051049	0.396	regulation of transport
GO:0007268	0.307	chemical synaptic transmission

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098793	0.997	presynapse
GO:0071944	0.988	cell periphery
GO:0005737	0.988	cytoplasm
GO:0048786	0.986	presynaptic active zone
GO:0016020	0.956	membrane
GO:0043227	0.928	membrane-bounded organelle
GO:0031982	0.922	vesicle
GO:0005886	0.864	plasma membrane
GO:0043229	0.697	intracellular organelle
GO:0032991	0.434	protein-containing complex
GO:0043231	0.312	intracellular membrane-bounded organelle
GO:0098978	0.311	glutamatergic synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]