StarFunc result for job id Q9UQ52

User Input

>input (1028 residues)
MRLLWKLVILLPLINSSAGDGLLSRPIFTQEPHDVIFPLDLSKSEVILNCAANGYPSPHY
RWKQNGTDIDFTMSYHYRLDGGSLAINSPHTDQDIGMYQCLATNLLGTILSRKAKLQFAY
IEDFETKTRSTVSVREGQGVVLLCGPPPHFGDLSYAWTFNDNPLYVQEDNRRFVSQETGN
LYIAKVEPSDVGNYTCFITNKEAQRSVQGPPTPLVQRTDGVMGEYEPKIEVRFPETIQAA
KDSSVKLECFALGNPVPDISWRRLDGSPLPGKVKYSKSQAILEIPNFQQEDEGFYECIAS
NLRGRNLAKGQLIFYAPPEWEQKIQNTHLSIYDNLLWECKASGKPNPWYTWLKNGERLNP
EERIQIENGTLIITMLNVSDSGVYQCAAENKYQIIYANAELRVLASAPDFSKSPVKKKSF
VQVGGDIVIGCKPNAFPRAAISWKRGTETLRQSKRIFLLEDGSLKIYNITRSDAGSYTCI
ATNQFGTAKNTGSLIVKERTVITVPPSKMDVTVGESIVLPCQVSHDPSIEVVFVWFFNGD
VIDLKKGVAHFERIGGESVGDLMIRNIQLHHSGKYLCTVQTTLESLSAVADIIVRGPPGP
PEDVQVEDISSTTSQLSWRAGPDNNSPIQIFTIQTRTPFSVGWQAVATVPEILNGKTYNA
TVVGLSPWVEYEFRVVAGNSIGIGEPSEPSELLRTKASVPVVAPVNIHGGGGSRSELVIT
WESIPEELQNGEGFGYIIMFRPVGSTTWSKEKVSSVESSRFVYRNESIIPLSPFEVKVGV
YNNEGEGSLSTVTIVYSGEDEPQLAPRGTSLQSFSASEMEVSWNAIAWNRNTGRVLGYEV
LYWTDDSKESMIGKIRVSGNVTTKNITGLKANTIYFASVRAYNTAGTGPSSPPVNVTTKK
SPPSQPPANIAWKLTNSKLCLNWEHVKTMENESEVLGYKILYRQNRQSKTHILETNNTSA
ELLVPFEEDYLIEIRTVSDGGDGSSSEEIRIPKMSSLSSRGIQFLEPSTHFLSIVIVIFH
CFAIQPLI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8QA12	0.500	0.495	0.000	1040	0.384	0.380	A0A2R8QA12.pdb.gz
2	AFDB:A4JYP8	0.522	0.521	0.000	1032	0.387	0.386	A4JYP8.pdb.gz	A4JYP8_DANRE Cntn1a OS=Danio rerio OX=7955 GN=F3 PE=1 SV=1
3	AFDB:B3DH04	0.554	0.548	0.000	1040	0.419	0.414	B3DH04.pdb.gz
4	AFDB:O94779	0.652	0.613	0.000	1100	0.497	0.465	O94779.pdb.gz	CNTN5_HUMAN Contactin-5 OS=Homo sapiens OX=9606 GN=CNTN5 PE=1 SV=2
5	AFDB:P14781	0.496	0.502	0.000	1010	0.408	0.415	P14781.pdb.gz	CNTN1_CHICK Contactin-1 OS=Gallus gallus OX=9031 GN=CNTN1 PE=1 SV=1
6	AFDB:P22063	0.621	0.615	0.000	1040	0.428	0.423	P22063.pdb.gz	CNTN2_RAT Contactin-2 OS=Rattus norvegicus OX=10116 GN=Cntn2 PE=1 SV=1
7	AFDB:P28685	0.588	0.584	0.000	1036	0.427	0.424	P28685.pdb.gz	CNTN2_CHICK Contactin-2 OS=Gallus gallus OX=9031 GN=CNTN2 PE=1 SV=1
8	AFDB:P97528	0.469	0.469	0.000	1028	0.897	0.897	P97528.pdb.gz	CNTN6_RAT Contactin-6 OS=Rattus norvegicus OX=10116 GN=Cntn6 PE=1 SV=1
9	AFDB:Q62682	0.801	0.801	0.000	1028	0.586	0.586	Q62682.pdb.gz	CNTN3_RAT Contactin-3 OS=Rattus norvegicus OX=10116 GN=Cntn3 PE=1 SV=1
10	AFDB:Q62845	0.436	0.436	0.000	1026	0.594	0.596	Q62845.pdb.gz	CNTN4_RAT Contactin-4 OS=Rattus norvegicus OX=10116 GN=Cntn4 PE=1 SV=1
11	PDB:5oj2B	0.145	0.197	1.679E-29	692	0.135	0.201	5oj2B.pdb.gz
12	PDB:1e07A	0.164	0.234	2.546E-21	642	0.118	0.188	1e07A.pdb.gz
13	PDB:7sqcO0	0.136	0.127	2.764E-18	1140	0.097	0.088	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
14	PDB:7q5zA	0.135	0.112	6.794E-15	1344	0.081	0.062	7q5zA.pdb.gz
15	PDB:5a42A	0.103	0.075	1.171E-14	1597	0.103	0.066	5a42A.pdb.gz
16	PDB:7q1yA	0.142	0.114	7.532E-14	1374	0.085	0.063	7q1yA.pdb.gz
17	PDB:6dldD	0.158	0.506	1.784E-13	269	0.059	0.227	6dldD.pdb.gz
18	PDB:7vonA	0.143	0.116	2.809E-13	1399	0.083	0.061	7vonA.pdb.gz
19	PDB:8dtlA	0.112	0.146	4.843E-13	741	0.050	0.069	8dtlA.pdb.gz
20	PDB:6pxvA	0.114	0.136	5.807E-13	823	0.051	0.063	6pxvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4JYP8	0.0	729	1032	0.390	0.389	A4JYP8_DANRE Cntn1a OS=Danio rerio OX=7955 GN=F3 PE=1 SV=1
2	O94779	0.0	1048	1100	0.492	0.460	CNTN5_HUMAN Contactin-5 OS=Homo sapiens OX=9606 GN=CNTN5 PE=1 SV=2
3	P12960	0.0	801	1020	0.404	0.407	CNTN1_MOUSE Contactin-1 OS=Mus musculus OX=10090 GN=Cntn1 PE=1 SV=1
4	P14781	0.0	806	1010	0.406	0.413	CNTN1_CHICK Contactin-1 OS=Gallus gallus OX=9031 GN=CNTN1 PE=1 SV=1
5	P22063	0.0	798	1040	0.425	0.420	CNTN2_RAT Contactin-2 OS=Rattus norvegicus OX=10116 GN=Cntn2 PE=1 SV=1
6	P28685	0.0	826	1036	0.429	0.426	CNTN2_CHICK Contactin-2 OS=Gallus gallus OX=9031 GN=CNTN2 PE=1 SV=1
7	P68500	0.0	1035	1098	0.485	0.454	CNTN5_MOUSE Contactin-5 OS=Mus musculus OX=10090 GN=Cntn5 PE=1 SV=2
8	P97528	0.0	1926	1028	0.898	0.898	CNTN6_RAT Contactin-6 OS=Rattus norvegicus OX=10116 GN=Cntn6 PE=1 SV=1
9	Q02246	0.0	805	1040	0.418	0.413	CNTN2_HUMAN Contactin-2 OS=Homo sapiens OX=9606 GN=CNTN2 PE=1 SV=1
10	Q12860	0.0	802	1018	0.405	0.409	CNTN1_HUMAN Contactin-1 OS=Homo sapiens OX=9606 GN=CNTN1 PE=1 SV=1
11	Q61330	0.0	799	1040	0.426	0.421	CNTN2_MOUSE Contactin-2 OS=Mus musculus OX=10090 GN=Cntn2 PE=1 SV=2
12	Q62682	0.0	1305	1028	0.591	0.591	CNTN3_RAT Contactin-3 OS=Rattus norvegicus OX=10116 GN=Cntn3 PE=1 SV=1
13	Q62845	0.0	1319	1026	0.602	0.603	CNTN4_RAT Contactin-4 OS=Rattus norvegicus OX=10116 GN=Cntn4 PE=1 SV=1
14	Q63198	0.0	801	1021	0.404	0.406	CNTN1_RAT Contactin-1 OS=Rattus norvegicus OX=10116 GN=Cntn1 PE=1 SV=2
15	Q8IWV2	0.0	1316	1026	0.600	0.601	CNTN4_HUMAN Contactin-4 OS=Homo sapiens OX=9606 GN=CNTN4 PE=1 SV=1
16	Q9JMB8	0.0	1917	1028	0.893	0.893	CNTN6_MOUSE Contactin-6 OS=Mus musculus OX=10090 GN=Cntn6 PE=1 SV=2
17	Q9P232	0.0	1313	1028	0.591	0.591	CNTN3_HUMAN Contactin-3 OS=Homo sapiens OX=9606 GN=CNTN3 PE=1 SV=3
18	Q9UQ52	0.0	2115	1028	1.000	1.000	CNTN6_HUMAN Contactin-6 OS=Homo sapiens OX=9606 GN=CNTN6 PE=1 SV=1
19	Q9W675	0.0	836	1040	0.423	0.418	Q9W675_DANRE Contactin-2 precursor OS=Danio rerio OX=7955 GN=tag1 PE=1 SV=1
20	Q9VN14	5.39e-141	459	1390	0.302	0.223	CONT_DROME Contactin OS=Drosophila melanogaster OX=7227 GN=Cont PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02440 Adeno_E3_CR1	6.4e+02	11.5	Adenovirus E3 region protein CR1
2	PF05790 C2-set	3	19.4	Immunoglobulin C2-set domain
3	PF08205 C2-set_2	2e-05	35.8	CD80-like C2-set immunoglobulin domain
4	PF00041 fn3	5.1e-32	121.4	Fibronectin type III domain
5	PF16794 fn3_4	55	15.1	Fibronectin-III type domain
6	PF07679 I-set	1.6e-68	238.2	Immunoglobulin I-set domain
7	PF00047 ig	1.3e-39	145.6	Immunoglobulin domain
8	PF13895 Ig_2	1.2e-44	161.8	Immunoglobulin domain
9	PF13927 Ig_3	2.3e-72	250.8	Immunoglobulin domain
10	PF16680 Ig_4	0.00028	32.7	T-cell surface glycoprotein CD3 delta chain
11	PF16681 Ig_5	1.8e-06	39.6	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
12	PF18452 Ig_6	0.0028	28.9	Immunoglobulin domain
13	PF09294 Interfer-bind	10	17.8	Interferon-alpha/beta receptor, fibronectin type III
14	PF16706 Izumo-Ig	0.58	21.5	Izumo-like Immunoglobulin domain
15	PF16656 Pur_ac_phosph_N	0.013	27.4	Purple acid Phosphatase, N-terminal domain
16	PF11465 Receptor_2B4	1.1e+02	14.4	Natural killer cell receptor 2B4
17	PF01108 Tissue_fac	1.2	20.4	Tissue factor
18	PF07686 V-set	2.1e-23	93.9	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000407822

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000277541	0.996	Neurogenic locus notch homolog protein 1
2	9606.ENSP00000256509	0.907	Neural cell adhesion molecule L1-like protein
3	9606.ENSP00000294785	0.905	Nicastrin
4	9606.ENSP00000358105	0.901	Gamma-secretase subunit APH-1A
5	9606.ENSP00000468411	0.901	Gamma-secretase subunit PEN-2
6	9606.ENSP00000261879	0.900	Gamma-secretase subunit APH-1B
7	9606.ENSP00000418112	0.787	Receptor-type tyrosine-protein phosphatase gamma
8	9606.ENSP00000305988	0.764	CD166 antigen
9	9606.ENSP00000479536	0.751	CD177 antigen
10	9606.ENSP00000479811	0.676	Contactin-associated protein-like 4
11	9606.ENSP00000278947	0.660	Sodium channel subunit beta-2
12	9606.ENSP00000270233	0.647	Basal cell adhesion molecule
13	9606.ENSP00000293662	0.645	General receptor for phosphoinositides 1-associated scaffold protein
14	9606.ENSP00000354778	0.617	Contactin-associated protein-like 2
15	9606.ENSP00000345229	0.609	Delta and Notch-like epidermal growth factor-related receptor
16	9606.ENSP00000382675	0.603	Adropin
17	9606.ENSP00000323280	0.602	T-cell differentiation antigen CD6
18	9606.ENSP00000164640	0.569	PDZ domain containing 4
19	9606.ENSP00000385142	0.557	Neurexin-1
20	9606.ENSP00000399013	0.523	Contactin-associated protein-like 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.589	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0007155	0.964	cell adhesion
GO:0065007	0.960	biological regulation
GO:0050789	0.947	regulation of biological process
GO:0032501	0.939	multicellular organismal process
GO:0048856	0.915	anatomical structure development
GO:0007275	0.907	multicellular organism development
GO:0048731	0.866	system development
GO:0050794	0.834	regulation of cellular process
GO:0007399	0.733	nervous system development
GO:0050896	0.453	response to stimulus
GO:0048518	0.445	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005576	0.946	extracellular region
GO:0043226	0.709	organelle
GO:0043227	0.678	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]