StarFunc result for job id Q9UQ84

User Input

>input (846 residues)
MGIQGLLQFIKEASEPIHVRKYKGQVVAVDTYCWLHKGAIACAEKLAKGEPTDRYVGFCM
KFVNMLLSHGIKPILVFDGCTLPSKKEVERSRRERRQANLLKGKQLLREGKVSEARECFT
RSINITHAMAHKVIKAARSQGVDCLVAPYEADAQLAYLNKAGIVQAIITEDSDLLAFGCK
KVILKMDQFGNGLEIDQARLGMCRQLGDVFTEEKFRYMCILSGCDYLSSLRGIGLAKACK
VLRLANNPDIVKVIKKIGHYLKMNITVPEDYINGFIRANNTFLYQLVFDPIKRKLIPLNA
YEDDVDPETLSYAGQYVDDSIALQIALGNKDINTFEQIDDYNPDTAMPAHSRSHSWDDKT
CQKSANVSSIWHRNYSPRPESGTVSDAPQLKENPSTVGVERVISTKGLNLPRKSSIVKRP
RSAELSEDDLLSQYSLSFTKKTKKNSSEGNKSLSFSEVFVPDLVNGPTNKKSVSTPPRTR
NKFATFLQRKNEESGAVVVPGTRSRFFCSSDSTDCVSNKVSIQPLDETAVTDKENNLHES
EYGDQEGKRLVDTDVARNSSDDIPNNHIPGDHIPDKATVFTDEESYSFESSKFTRTISPP
TLGTLRSCFSWSGGLGDFSRTPSPSPSTALQQFRRKSDSPTSLPENNMSDVSQLKSEESS
DDESHPLREEACSSQSQESGEFSLQSSNASKLSQCSSKDSDSEESDCNIKLLDSQSDQTS
KLRLSHFSKKDTPLRNKVPGLYKSSSADSLSTTKIKPLGPARASGLSKKPASIQKRKHHN
AENKPGLQIKLNELWKNFGFKKDSEKLPPCKKPLSPVRDNIQLTPEAEEDIFNKPECGRV
QRAIFQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UQ84	1.000	1.000	0.000	846	1.000	1.000	Q9UQ84.pdb.gz	EXO1_HUMAN Exonuclease 1 OS=Homo sapiens OX=9606 GN=EXO1 PE=1 SV=2
2	AFDB:Q9QZ11	0.554	0.560	8.221E-87	837	0.728	0.736	Q9QZ11.pdb.gz	EXO1_MOUSE Exonuclease 1 OS=Mus musculus OX=10090 GN=Exo1 PE=2 SV=2
3	AFDB:Q54ED2	0.398	0.324	2.921E-34	1046	0.254	0.206	Q54ED2.pdb.gz	EXO1_DICDI Exonuclease 1 OS=Dictyostelium discoideum OX=44689 GN=exo1 PE=3 SV=1
4	AFDB:Q8L6Z7	0.380	0.437	1.990E-32	735	0.247	0.284	Q8L6Z7.pdb.gz	EXO1_ARATH Exonuclease 1 OS=Arabidopsis thaliana OX=3702 GN=EXO1 PE=2 SV=2
5	AFDB:P53695	0.380	0.558	1.580E-30	571	0.201	0.298	P53695.pdb.gz	EXO1_SCHPO Exodeoxyribonuclease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exo1 PE=1 SV=1
6	AFDB:P39875	0.382	0.459	3.839E-28	702	0.227	0.274	P39875.pdb.gz	EXO1_YEAST Exodeoxyribonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EXO1 PE=1 SV=2
7	PDB:1ul1Z	0.288	0.656	8.866E-12	349	0.103	0.249	1ul1Z.pdb.gz	Structural basis for recruitment of human flap endonuclease 1 to PCNA
8	PDB:1ul1X	0.259	0.661	1.551E-11	313	0.105	0.284	1ul1X.pdb.gz	Structural basis for recruitment of human flap endonuclease 1 to PCNA
9	PDB:5hnkA	0.199	0.509	7.941E-4	272	0.043	0.132	5hnkA.pdb.gz	Direct observation of DNA threading in flap endonuclease complexes.
10	PDB:1xo1A	0.152	0.440	7.444E-3	245	0.043	0.147	1xo1A.pdb.gz
11	PDB:3h7iA	0.154	0.359	1.238E-2	302	0.053	0.149	3h7iA.pdb.gz
12	PDB:3milA	0.071	0.206	1.834E-1	240	0.026	0.092	3milA.pdb.gz
13	PDB:7k0mA	0.077	0.108	3.934E-1	464	0.041	0.075	7k0mA.pdb.gz	Structural insights into the regulation of human serine palmitoyltransferase complexes.
14	PDB:1o9gA	0.095	0.266	5.909E-1	249	0.027	0.092	1o9gA.pdb.gz
15	PDB:2bneB	0.084	0.250	6.217E-1	238	0.021	0.076	2bneB.pdb.gz	Structure of Escherichia Coli Ump Kinase Differs from that of Other Nucleoside Monophosphate Kinases and Sheds New Light on Enzyme Regulation.
16	PDB:2c1zA	0.093	0.154	6.217E-1	439	0.043	0.082	2c1zA.pdb.gz	Structure of a Flavonoid Glucosyltransferase Reveals the Basis for Plant Natural Product Modification.
17	AFDB:O43303	0.057	0.050	1.924	1012	0.097	0.081	O43303.pdb.gz	CP110_HUMAN Centriolar coiled-coil protein of 110 kDa OS=Homo sapiens OX=9606 GN=CCP110 PE=1 SV=3
18	AFDB:O60641	0.049	0.046	4.127	907	0.116	0.108	O60641.pdb.gz	AP180_HUMAN Clathrin coat assembly protein AP180 OS=Homo sapiens OX=9606 GN=SNAP91 PE=1 SV=2
19	AFDB:Q6AWN7	0.069	0.059	4.807	1049	0.125	0.101	Q6AWN7.pdb.gz	Q6AWN7_DROME RE48574p OS=Drosophila melanogaster OX=7227 GN=ko PE=2 SV=1
20	AFDB:A0A509AIR7	0.038	0.032	5.058	1031	0.080	0.066	A0A509AIR7.pdb.gz	OMG1_PLABA Ookinete maturation protein 1 OS=Plasmodium berghei (strain Anka) OX=5823 GN=OMG1 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9QZ11	0.0	1208	837	0.735	0.743	EXO1_MOUSE Exonuclease 1 OS=Mus musculus OX=10090 GN=Exo1 PE=2 SV=2
2	Q9UQ84	0.0	1750	846	1.000	1.000	EXO1_HUMAN Exonuclease 1 OS=Homo sapiens OX=9606 GN=EXO1 PE=1 SV=2
3	Q5T397	6.21e-111	338	169	0.200	1.000	Q5T397_HUMAN Exonuclease 1 (Fragment) OS=Homo sapiens OX=9606 GN=EXO1 PE=1 SV=1
4	Q5T398	1.09e-106	327	166	0.196	1.000	Q5T398_HUMAN Exonuclease 1 (Fragment) OS=Homo sapiens OX=9606 GN=EXO1 PE=1 SV=1
5	Q8L6Z7	4.37e-82	281	735	0.183	0.211	EXO1_ARATH Exonuclease 1 OS=Arabidopsis thaliana OX=3702 GN=EXO1 PE=2 SV=2
6	Q54ED2	1.52e-73	263	1046	0.180	0.145	EXO1_DICDI Exonuclease 1 OS=Dictyostelium discoideum OX=44689 GN=exo1 PE=3 SV=1
7	P53695	1.86e-71	248	571	0.151	0.224	EXO1_SCHPO Exodeoxyribonuclease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exo1 PE=1 SV=1
8	P39875	3.16e-64	231	702	0.142	0.171	EXO1_YEAST Exodeoxyribonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EXO1 PE=1 SV=2
9	Q12086	8.81e-54	195	430	0.132	0.260	DIN7_YEAST DNA damage-inducible protein DIN7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DIN7 PE=2 SV=1
10	Q57YZ1	1.44e-45	178	797	0.145	0.154	Q57YZ1_TRYB2 Exonuclease, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28L1.200 PE=3 SV=1
11	Q9N3T2	2.51e-23	105	382	0.103	0.228	FEN1_CAEEL Flap endonuclease 1 OS=Caenorhabditis elegans OX=6239 GN=crn-1 PE=1 SV=1
12	Q7K734	5.24e-23	107	672	0.098	0.124	FEN1_PLAF7 Flap endonuclease 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=FEN1 PE=1 SV=1
13	Q5XIP6	5.73e-23	104	380	0.108	0.239	FEN1_RAT Flap endonuclease 1 OS=Rattus norvegicus OX=10116 GN=Fen1 PE=2 SV=1
14	P39749	4.24e-21	98.6	378	0.104	0.233	FEN1_MOUSE Flap endonuclease 1 OS=Mus musculus OX=10090 GN=Fen1 PE=1 SV=1
15	P39748	1.26e-20	97.1	380	0.109	0.242	FEN1_HUMAN Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1 PE=1 SV=1
16	Q6FHX6	1.26e-20	97.1	380	0.109	0.242	Q6FHX6_HUMAN Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1 PE=2 SV=1
17	P70040	1.86e-20	96.7	382	0.113	0.251	FEN1A_XENLA Flap endonuclease 1-A OS=Xenopus laevis OX=8355 GN=fen1-a PE=1 SV=1
18	Q6TNU4	7.59e-20	94.7	380	0.108	0.239	FEN1A_DANRE Flap endonuclease 1 OS=Danio rerio OX=7955 GN=fen1 PE=2 SV=1
19	P70054	3.49e-19	92.8	382	0.111	0.246	FEN1B_XENLA Flap endonuclease 1-B OS=Xenopus laevis OX=8355 GN=fen1-b PE=1 SV=1
20	P39750	5.66e-18	89.0	380	0.095	0.211	FEN1_SCHPO Flap endonuclease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00867 XPG_I	6e-19	79.6	XPG I-region
2	PF12813 XPG_I_2	6.3	17.8	XPG domain containing
3	PF00752 XPG_N	1e-18	79.0	XPG N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355506

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231790	0.999	DNA mismatch repair protein Mlh1
2	9606.ENSP00000233146	0.999	DNA mismatch repair protein Msh2
3	9606.ENSP00000347232	0.999	Bloom syndrome protein
4	9606.ENSP00000351185	0.999	DNA replication ATP-dependent helicase/nuclease DNA2
5	9606.ENSP00000298139	0.998	Werner syndrome ATP-dependent helicase
6	9606.ENSP00000372088	0.996	DNA repair protein RAD51 homolog 1
7	9606.ENSP00000265849	0.995	Mismatch repair endonuclease PMS2
8	9606.ENSP00000234420	0.994	DNA mismatch repair protein Msh6
9	9606.ENSP00000382628	0.994	DNA endonuclease RBBP8
10	9606.ENSP00000265081	0.993	DNA mismatch repair protein Msh3
11	9606.ENSP00000307853	0.993	Crossover junction endonuclease MUS81
12	9606.ENSP00000325863	0.993	Double-strand break repair protein MRE11
13	9606.ENSP00000376952	0.990	Crossover junction endonuclease EME1
14	9606.ENSP00000406046	0.990	DNA polymerase delta catalytic subunit
15	9606.ENSP00000352257	0.989	X-ray repair cross-complementing protein 6
16	9606.ENSP00000013807	0.987	DNA excision repair protein ERCC-1
17	9606.ENSP00000388648	0.987	Serine/threonine-protein kinase Chk1
18	9606.ENSP00000322570	0.986	DNA polymerase epsilon catalytic subunit A
19	9606.ENSP00000343741	0.986	Serine/threonine-protein kinase ATR
20	9606.ENSP00000310520	0.984	DNA repair endonuclease XPF

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0048256	1.000	flap endonuclease activity
GO:0004523	1.000	RNA-DNA hybrid ribonuclease activity
GO:0003677	0.999	DNA binding
GO:0035312	0.999	5'-3' DNA exonuclease activity
GO:0008297	0.996	single-stranded DNA exodeoxyribonuclease activity
GO:0008309	0.875	double-stranded DNA exodeoxyribonuclease activity
GO:0051908	0.741	double-stranded DNA 5'-3' exodeoxyribonuclease activity
GO:0045145	0.507	single-stranded DNA 5'-3' DNA exonuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0071704	0.996	organic substance metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0044238	0.995	primary metabolic process
GO:0051716	0.992	cellular response to stimulus
GO:0006950	0.988	response to stress
GO:0006259	0.987	DNA metabolic process
GO:0006974	0.982	cellular response to DNA damage stimulus
GO:0006310	0.973	DNA recombination
GO:0006281	0.959	DNA repair
GO:0016043	0.900	cellular component organization
GO:0006996	0.874	organelle organization
GO:0044085	0.868	cellular component biogenesis
GO:0051276	0.855	chromosome organization
GO:0000723	0.747	telomere maintenance
GO:0006298	0.654	mismatch repair
GO:0050794	0.382	regulation of cellular process
GO:0022607	0.331	cellular component assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0016020	0.998	membrane
GO:0005886	0.993	plasma membrane
GO:0016604	0.990	nuclear body
GO:0043232	0.957	intracellular non-membrane-bounded organelle
GO:0005694	0.795	chromosome
GO:0005737	0.729	cytoplasm
GO:0032991	0.492	protein-containing complex
GO:0005856	0.306	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.26.4	1.000	ribonuclease H.
EC:3.1.11.-	0.999	Exodeoxyribonucleases producing 5'-phosphomonoesters.

[back to server]