StarFunc result for job id Q9UQ90

User Input

>input (795 residues)
MAVLLLLLRALRRGPGPGPRPLWGPGPAWSPGFPARPGRGRPYMASRPPGDLAEAGGRAL
QSLQLRLLTPTFEGINGLLLKQHLVQNPVRLWQLLGGTFYFNTSRLKQKNKEKDKSKGKA
PEEDEEERRRRERDDQMYRERLRTLLVIAVVMSLLNALSTSGGSISWNDFVHEMLAKGEV
QRVQVVPESDVVEVYLHPGAVVFGRPRLALMYRMQVANIDKFEEKLRAAEDELNIEAKDR
IPVSYKRTGFFGNALYSVGMTAVGLAILWYVFRLAGMTGREGGFSAFNQLKMARFTIVDG
KMGKGVSFKDVAGMHEAKLEVREFVDYLKSPERFLQLGAKVPKGALLLGPPGCGKTLLAK
AVATEAQVPFLAMAGPEFVEVIGGLGAARVRSLFKEARARAPCIVYIDEIDAVGKKRSTT
MSGFSNTEEEQTLNQLLVEMDGMGTTDHVIVLASTNRADILDGALMRPGRLDRHVFIDLP
TLQERREIFEQHLKSLKLTQSSTFYSQRLAELTPGFSGADIANICNEAALHAAREGHTSV
HTLNFEYAVERVLAGTAKKSKILSKEEQKVVAFHESGHALVGWMLEHTEAVMKVSITPRT
NAALGFAQMLPRDQHLFTKEQLFERMCMALGGRASEALSFNEVTSGAQDDLRKVTRIAYS
MVKQFGMAPGIGPISFPEAQEGLMGIGRRPFSQGLQQMMDHEARLLVAKAYRHTEKVLQD
NLDKLQALANALLEKEVINYEDIEALIGPPPHGPKKMIAPQRWIDAQREKQDLGEEETEE
TQQPPLGGEEPTWPK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3ULF4	0.852	0.867	0.000	781	0.867	0.882	Q3ULF4.pdb.gz	SPG7_MOUSE Paraplegin OS=Mus musculus OX=10090 GN=Spg7 PE=1 SV=1
2	AFDB:Q9UQ90	1.000	1.000	0.000	795	1.000	1.000	Q9UQ90.pdb.gz	SPG7_HUMAN Paraplegin OS=Homo sapiens OX=9606 GN=SPG7 PE=1 SV=2
3	AFDB:Q9W4W8	0.588	0.571	1.456E-83	819	0.468	0.454	Q9W4W8.pdb.gz	Q9W4W8_DROME Paraplegin, isoform A OS=Drosophila melanogaster OX=7227 GN=Spg7 PE=1 SV=1
4	AFDB:Q8VZI8	0.680	0.667	5.828E-74	813	0.377	0.369	Q8VZI8.pdb.gz	FTSHA_ARATH ATP-dependent zinc metalloprotease FTSH 10, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FTSH10 PE=1 SV=1
5	AFDB:Q9N3T5	0.575	0.584	1.266E-71	782	0.350	0.355	Q9N3T5.pdb.gz	AFG3_CAEEL AFG3-like protein spg-7 OS=Caenorhabditis elegans OX=6239 GN=spg-7 PE=3 SV=2
6	AFDB:P39925	0.593	0.619	1.743E-71	761	0.395	0.413	P39925.pdb.gz	AFG3_YEAST Mitochondrial respiratory chain complexes assembly protein AFG3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AFG3 PE=1 SV=1
7	AFDB:F1LN92	0.597	0.592	1.939E-71	802	0.392	0.389	F1LN92.pdb.gz	F1LN92_RAT AFG3 like matrix AAA peptidase subunit 2 OS=Rattus norvegicus OX=10116 GN=Afg3l2 PE=1 SV=1
8	AFDB:Q8T4G5	0.687	0.663	1.939E-71	826	0.375	0.361	Q8T4G5.pdb.gz	Q8T4G5_DROME AFG3 like matrix AAA peptidase subunit 2, isoform A OS=Drosophila melanogaster OX=7227 GN=Afg3l2 PE=1 SV=1
9	AFDB:Q920A7	0.699	0.704	3.484E-71	789	0.394	0.397	Q920A7.pdb.gz	AFG31_MOUSE AFG3-like protein 1 OS=Mus musculus OX=10090 GN=Afg3l1 PE=1 SV=2
10	AFDB:P40341	0.646	0.624	1.817E-70	825	0.375	0.361	P40341.pdb.gz	YTA12_YEAST Mitochondrial respiratory chain complexes assembly protein YTA12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YTA12 PE=1 SV=2
11	PDB:7tdoA	0.473	0.851	1.228E-39	420	0.243	0.460	7tdoA.pdb.gz	Cryo-EM structure of transmembrane AAA+ protease FtsH in the ADP state.
12	PDB:7wi4A	0.451	0.849	2.210E-30	410	0.201	0.390	7wi4A.pdb.gz	Cryo-EM structure of the entire FtsH-HflKC AAA protease complex.
13	PDB:6fvtM	0.310	0.570	3.816E-22	421	0.128	0.242	6fvtM.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
14	PDB:5l4gM	0.304	0.569	1.696E-21	415	0.114	0.219	5l4gM.pdb.gz	Structure of the human 26S proteasome at a resolution of 3.9 angstrom.
15	PDB:5mp9M	0.311	0.628	3.978E-21	381	0.125	0.260	5mp9M.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
16	PDB:5l4gL	0.306	0.604	4.425E-21	389	0.150	0.306	5l4gL.pdb.gz	Structure of the human 26S proteasome at a resolution of 3.9 angstrom.
17	PDB:5mp9I	0.291	0.587	9.841E-21	385	0.122	0.252	5mp9I.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
18	PDB:6opcB	0.284	0.304	2.568E-20	741	0.127	0.136	6opcB.pdb.gz	Structure of the Cdc48 segregase in the act of unfolding an authentic substrate.
19	PDB:6fvtH	0.298	0.546	3.932E-20	426	0.125	0.232	6fvtH.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
20	PDB:7ln6F	0.286	0.318	4.866E-20	714	0.125	0.139	7ln6F.pdb.gz	Mechanistic insight into substrate processing and allosteric inhibition of human p97.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3ULF4	0.0	1358	781	0.849	0.864	SPG7_MOUSE Paraplegin OS=Mus musculus OX=10090 GN=Spg7 PE=1 SV=1
2	Q7TT47	0.0	1358	781	0.850	0.866	SPG7_RAT Paraplegin OS=Rattus norvegicus OX=10116 GN=Spg7 PE=2 SV=2
3	Q9UQ90	0.0	1629	795	1.000	1.000	SPG7_HUMAN Paraplegin OS=Homo sapiens OX=9606 GN=SPG7 PE=1 SV=2
4	Q9W4W8	0.0	691	819	0.438	0.425	Q9W4W8_DROME Paraplegin, isoform A OS=Drosophila melanogaster OX=7227 GN=Spg7 PE=1 SV=1
5	A0A8I5ZLF3	6.75e-179	534	773	0.374	0.384	A0A8I5ZLF3_RAT AFG3 like matrix AAA peptidase subunit 2 OS=Rattus norvegicus OX=10116 GN=Afg3l2 PE=1 SV=1
6	Q8JZQ2	1.29e-178	534	802	0.375	0.372	AFG32_MOUSE AFG3-like protein 2 OS=Mus musculus OX=10090 GN=Afg3l2 PE=1 SV=1
7	F1LN92	2.40e-178	534	802	0.374	0.370	F1LN92_RAT AFG3 like matrix AAA peptidase subunit 2 OS=Rattus norvegicus OX=10116 GN=Afg3l2 PE=1 SV=1
8	Q9Y4W6	2.82e-178	533	797	0.377	0.376	AFG32_HUMAN AFG3-like protein 2 OS=Homo sapiens OX=9606 GN=AFG3L2 PE=1 SV=2
9	P40341	9.19e-174	523	825	0.362	0.349	YTA12_YEAST Mitochondrial respiratory chain complexes assembly protein YTA12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YTA12 PE=1 SV=2
10	Q8VZI8	1.37e-170	514	813	0.364	0.355	FTSHA_ARATH ATP-dependent zinc metalloprotease FTSH 10, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FTSH10 PE=1 SV=1
11	Q8T4G5	7.10e-169	510	826	0.341	0.328	Q8T4G5_DROME AFG3 like matrix AAA peptidase subunit 2, isoform A OS=Drosophila melanogaster OX=7227 GN=Afg3l2 PE=1 SV=1
12	P39925	8.99e-168	505	761	0.362	0.378	AFG3_YEAST Mitochondrial respiratory chain complexes assembly protein AFG3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AFG3 PE=1 SV=1
13	Q84WU8	6.02e-167	504	809	0.366	0.360	FTSH3_ARATH ATP-dependent zinc metalloprotease FTSH 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FTSH3 PE=1 SV=1
14	Q920A7	5.53e-165	499	789	0.351	0.354	AFG31_MOUSE AFG3-like protein 1 OS=Mus musculus OX=10090 GN=Afg3l1 PE=1 SV=2
15	Q9N3T5	1.12e-164	498	782	0.345	0.350	AFG3_CAEEL AFG3-like protein spg-7 OS=Caenorhabditis elegans OX=6239 GN=spg-7 PE=3 SV=2
16	Q9HGM3	2.48e-164	496	773	0.343	0.353	YTA12_SCHPO Mitochondrial respiratory chain complexes assembly protein rca1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=yta12 PE=3 SV=1
17	Q5AJC2	3.98e-163	494	795	0.371	0.371	Q5AJC2_CANAL AAA family ATPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=AFG3 PE=3 SV=1
18	P37476	2.95e-132	409	637	0.268	0.334	FTSH_BACSU ATP-dependent zinc metalloprotease FtsH OS=Bacillus subtilis (strain 168) OX=224308 GN=ftsH PE=1 SV=1
19	Q9WZ49	6.69e-132	407	610	0.278	0.362	FTSH_THEMA ATP-dependent zinc metalloprotease FtsH OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=ftsH PE=1 SV=1
20	Q55700	2.44e-125	391	627	0.288	0.365	FTSH2_SYNY3 ATP-dependent zinc metalloprotease FtsH 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=ftsH2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	2.8e-35	133.0	ATPase family associated with various cellular activities (AAA)
2	PF13191 AAA_16	9.9	18.0	AAA ATPase domain
3	PF13207 AAA_17	0.34	22.8	AAA domain
4	PF07724 AAA_2	2.1	19.9	AAA domain (Cdc48 subfamily)
5	PF13401 AAA_22	0.44	22.3	AAA domain
6	PF07728 AAA_5	0.03	25.8	AAA domain (dynein-related subfamily)
7	PF17862 AAA_lid_3	3.2e-10	51.0	AAA+ lid domain
8	PF06480 FtsH_ext	5.2e-06	38.2	FtsH Extracellular
9	PF01695 IstB_IS21	88	14.0	IstB-like ATP binding protein
10	PF01078 Mg_chelatase	65	14.4	Magnesium chelatase, subunit ChlI
11	PF05729 NACHT	3.7e+02	12.4	NACHT domain
12	PF01434 Peptidase_M41	5.5e-62	220.5	Peptidase family M41
13	PF05496 RuvB_N	0.65	21.2	Holliday junction DNA helicase RuvB P-loop domain
14	PF06068 TIP49	1.2e+02	13.3	TIP49 P-loop domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000268704

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000225174	0.987	Peptidyl-prolyl cis-trans isomerase F, mitochondrial
2	9606.ENSP00000249269	0.960	Mitochondrial-processing peptidase subunit beta
3	9606.ENSP00000265333	0.959	Voltage-dependent anion-selective channel protein 1
4	9606.ENSP00000360782	0.939	Mitochondrial-processing peptidase subunit alpha
5	9606.ENSP00000441875	0.927	Prohibitin-2
6	9606.ENSP00000479488	0.912	Prohibitin
7	9606.ENSP00000223642	0.900	Complement C5
8	9606.ENSP00000263408	0.900	Complement component C9
9	9606.ENSP00000263413	0.900	Complement component C6
10	9606.ENSP00000322061	0.900	Complement component C7
11	9606.ENSP00000354458	0.900	Complement component C8 alpha chain
12	9606.ENSP00000360281	0.900	Complement component C8 beta chain
13	9606.ENSP00000295079	0.881	m-AAA protease-interacting protein 1, mitochondrial
14	9606.ENSP00000358909	0.851	Sideroflexin-2
15	9606.ENSP00000325421	0.841	Presenilins-associated rhomboid-like protein, mitochondrial
16	9606.ENSP00000353826	0.810	Lon protease homolog, mitochondrial
17	9606.ENSP00000362144	0.805	Calcium uniporter protein, mitochondrial
18	9606.ENSP00000311579	0.793	Tankyrase-1
19	9606.ENSP00000354415	0.777	Calcium uptake protein 1, mitochondrial
20	9606.ENSP00000261866	0.773	Spatacsin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.997	catalytic activity
GO:0016787	0.991	hydrolase activity
GO:0051082	0.966	unfolded protein binding
GO:0004175	0.966	endopeptidase activity
GO:0004222	0.962	metalloendopeptidase activity
GO:0140657	0.430	ATP-dependent activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0006996	0.987	organelle organization
GO:0007005	0.967	mitochondrion organization
GO:0065007	0.960	biological regulation
GO:0051179	0.895	localization
GO:0051234	0.860	establishment of localization
GO:0006810	0.831	transport
GO:0008152	0.813	metabolic process
GO:0006839	0.783	mitochondrial transport
GO:0044238	0.763	primary metabolic process
GO:0071704	0.762	organic substance metabolic process
GO:0006807	0.755	nitrogen compound metabolic process
GO:0043170	0.754	macromolecule metabolic process
GO:1901564	0.745	organonitrogen compound metabolic process
GO:0007006	0.700	mitochondrial membrane organization
GO:0090559	0.679	regulation of membrane permeability
GO:0019538	0.566	protein metabolic process
GO:0050789	0.417	regulation of biological process
GO:0044237	0.347	cellular metabolic process
GO:0050794	0.313	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0031966	0.999	mitochondrial membrane
GO:0005743	0.994	mitochondrial inner membrane
GO:0098798	0.982	mitochondrial protein-containing complex
GO:0098796	0.979	membrane protein complex
GO:0098800	0.513	inner mitochondrial membrane protein complex
GO:0043233	0.334	organelle lumen
GO:0070013	0.317	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.991	Hydrolases.
EC:3.4.-.-	0.966	Acting on peptide bonds (peptidases).
EC:3.4.24.-	0.962	Metalloendopeptidases.

[back to server]