StarFunc result for job id Q9UQB3

User Input

>input (1225 residues)
MFARKPPGAAPLGAMPVPDQPSSASEKTSSLSPGLNTSNGDGSETETTSAILASVKEQEL
QFERLTRELEAERQIVASQLERCKLGSETGSMSSMSSAEEQFQWQSQDGQKDIEDELTTG
LELVDSCIRSLQESGILDPQDYSTGERPSLLSQSALQLNSKPEGSFQYPASYHSNQTLAL
GETTPSQLPARGTQARATGQSFSQGTTSRAGHLAGPEPAPPPPPPPREPFAPSLGSAFHL
PDAPPAAAAAALYYSSSTLPAPPRGGSPLAAPQGGSPTKLQRGGSAPEGATYAAPRGSSP
KQSPSRLAKSYSTSSPINIVVSSAGLSPIRVTSPPTVQSTISSSPIHQLSSTIGTYATLS
PTKRLVHASEQYSKHSQELYATATLQRPGSLAAGSRASYSSQHGHLGPELRALQSPEHHI
DPIYEDRVYQKPPMRSLSQSQGDPLPPAHTGTYRTSTAPSSPGVDSVPLQRTGSQHGPQN
AAAATFQRASYAAGPASNYADPYRQLQYCPSVESPYSKSGPALPPEGTLARSPSIDSIQK
DPREFGWRDPELPEVIQMLQHQFPSVQSNAAAYLQHLCFGDNKIKAEIRRQGGIQLLVDL
LDHRMTEVHRSACGALRNLVYGKANDDNKIALKNCGGIPALVRLLRKTTDLEIRELVTGV
LWNLSSCDALKMPIIQDALAVLTNAVIIPHSGWENSPLQDDRKIQLHSSQVLRNATGCLR
NVSSAGEEARRRMRECDGLTDALLYVIQSALGSSEIDSKTVENCVCILRNLSYRLAAETS
QGQHMGTDELDGLLCGEANGKDAESSGCWGKKKKKKKSQDQWDGVGPLPDCAEPPKGIQM
LWHPSIVKPYLTLLSECSNPDTLEGAAGALQNLAAGSWKWSVYIRAAVRKEKGLPILVEL
LRIDNDRVVCAVATALRNMALDVRNKELIGKYAMRDLVHRLPGGNNSNNTASKAMSDDTV
TAVCCTLHEVITKNMENAKALRDAGGIEKLVGISKSKGDKHSPKVVKAASQVLNSMWQYR
DLRSLYKKDGWSQYHFVASSSTIERDRQRPYSSSRTPSISPVRVSPNNRSASAPASPREM
ISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLYRNSYGAPAEDIKHNQV
SAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLGLKSTGNYVDF
YSAARPYSELNYETSHYPASPDSWV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35927	0.554	0.545	0.000	1247	0.967	0.949	O35927.pdb.gz	CTND2_MOUSE Catenin delta-2 OS=Mus musculus OX=10090 GN=Ctnnd2 PE=1 SV=1
2	AFDB:Q9UQB3	1.000	1.000	0.000	1225	1.000	1.000	Q9UQB3.pdb.gz	CTND2_HUMAN Catenin delta-2 OS=Homo sapiens OX=9606 GN=CTNND2 PE=1 SV=3
3	AFDB:F1RBK4	0.472	0.475	1.028E-89	1216	0.770	0.775	F1RBK4.pdb.gz
4	AFDB:Q99569	0.490	0.502	7.927E-62	1192	0.500	0.514	Q99569.pdb.gz	PKP4_HUMAN Plakophilin-4 OS=Homo sapiens OX=9606 GN=PKP4 PE=1 SV=2
5	AFDB:A1L266	0.241	0.361	5.235E-53	794	0.491	0.758	A1L266.pdb.gz
6	PDB:2z6gA	0.266	0.541	2.534E-11	550	0.081	0.180	2z6gA.pdb.gz
7	PDB:1wa5B	0.214	0.460	2.085E-9	466	0.070	0.185	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
8	PDB:7rroH7	0.141	0.270	5.924E-9	580	0.080	0.169	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
9	PDB:4r0zA	0.229	0.452	1.335E-8	557	0.069	0.153	4r0zA.pdb.gz
10	PDB:4tnmA	0.255	0.703	2.123E-8	407	0.061	0.184	4tnmA.pdb.gz
11	PDB:6kbnC	0.262	0.591	4.602E-8	504	0.078	0.188	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
12	PDB:5tbkA	0.263	0.712	8.883E-8	417	0.059	0.173	5tbkA.pdb.gz
13	PDB:3tpoA	0.223	0.517	2.624E-7	438	0.064	0.180	3tpoA.pdb.gz
14	AFDB:Q7Z5K2	0.192	0.196	1.044E-6	1190	0.117	0.120	Q7Z5K2.pdb.gz	WAPL_HUMAN Wings apart-like protein homolog OS=Homo sapiens OX=9606 GN=WAPL PE=1 SV=1
15	AFDB:F4K0Y5	0.104	0.107	1.218E-6	1165	0.114	0.120	F4K0Y5.pdb.gz	F4K0Y5_ARATH Heat shock protein DnaJ with tetratricopeptide repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=TPR16 PE=1 SV=1
16	PDB:7nscE	0.195	0.340	4.251E-6	615	0.069	0.137	7nscE.pdb.gz
17	AFDB:Q57WC1	0.075	0.069	7.800E-6	1387	0.134	0.118	Q57WC1.pdb.gz	Q57WC1_TRYB2 Ancestral coatomer element 1 Sec16/Sec31 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.610 PE=3 SV=1
18	AFDB:A0A0R4IZ84	0.127	0.109	1.448E-5	1544	0.124	0.098	A0A0R4IZ84.pdb.gz	EST1A_DANRE Telomerase-binding protein EST1A OS=Danio rerio OX=7955 GN=smg6 PE=2 SV=1
19	AFDB:A8DZ29	0.073	0.058	2.304E-5	1919	0.138	0.088	A8DZ29.pdb.gz	A8DZ29_DROME Eukaryotic translation initiation factor 4G1, isoform B OS=Drosophila melanogaster OX=7227 GN=eIF4G1 PE=1 SV=1
20	PDB:3w3uA	0.159	0.181	4.330E-5	1030	0.061	0.073	3w3uA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0V2S9	0.0	1850	1210	0.772	0.782	B0V2S9_DANRE Catenin (cadherin-associated protein), delta 2b OS=Danio rerio OX=7955 GN=ctnnd2 PE=1 SV=1
2	O35116	0.0	559	264	0.216	1.000	CTND2_RAT Catenin delta-2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Ctnnd2 PE=1 SV=1
3	O35927	0.0	2417	1247	0.967	0.950	CTND2_MOUSE Catenin delta-2 OS=Mus musculus OX=10090 GN=Ctnnd2 PE=1 SV=1
4	Q68FH0	0.0	1064	1190	0.508	0.523	PKP4_MOUSE Plakophilin-4 OS=Mus musculus OX=10090 GN=Pkp4 PE=1 SV=1
5	Q99569	0.0	1063	1192	0.500	0.513	PKP4_HUMAN Plakophilin-4 OS=Homo sapiens OX=9606 GN=PKP4 PE=1 SV=2
6	Q9UQB3	0.0	2521	1225	1.000	1.000	CTND2_HUMAN Catenin delta-2 OS=Homo sapiens OX=9606 GN=CTNND2 PE=1 SV=3
7	P98203	9.19e-161	506	962	0.215	0.273	ARVC_MOUSE Splicing regulator ARVCF OS=Mus musculus OX=10090 GN=Arvcf PE=1 SV=2
8	O00192	7.34e-160	504	962	0.216	0.274	ARVC_HUMAN Splicing regulator ARVCF OS=Homo sapiens OX=9606 GN=ARVCF PE=1 SV=1
9	Q8T0H3	2.29e-156	481	562	0.211	0.459	Q8T0H3_DROME LD03740p OS=Drosophila melanogaster OX=7227 GN=p120ctn PE=2 SV=1
10	Q9NHP1	8.72e-156	488	781	0.214	0.335	Q9NHP1_DROME Arm repeat protein OS=Drosophila melanogaster OX=7227 GN=p120ctn PE=2 SV=1
11	Q7PLI0	1.22e-155	487	781	0.214	0.335	Q7PLI0_DROME Adherens junction protein p120 OS=Drosophila melanogaster OX=7227 GN=p120ctn PE=1 SV=1
12	P30999	2.81e-153	486	938	0.216	0.283	CTND1_MOUSE Catenin delta-1 OS=Mus musculus OX=10090 GN=Ctnnd1 PE=1 SV=2
13	D3ZZZ9	6.49e-153	483	892	0.211	0.289	D3ZZZ9_RAT Catenin delta 1 OS=Rattus norvegicus OX=10116 GN=Ctnnd1 PE=1 SV=2
14	A0A0G2JXM1	1.55e-152	485	967	0.216	0.273	A0A0G2JXM1_RAT Catenin delta 1 OS=Rattus norvegicus OX=10116 GN=Ctnnd1 PE=1 SV=1
15	A0A669KB05	3.71e-152	482	915	0.217	0.291	A0A669KB05_HUMAN Catenin delta 1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1
16	C9JZR2	7.77e-152	482	938	0.217	0.284	C9JZR2_HUMAN Catenin delta 1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=2
17	O60716	1.05e-151	483	968	0.217	0.275	CTND1_HUMAN Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1
18	A0A8I5ZVG2	3.09e-151	478	870	0.216	0.303	A0A8I5ZVG2_RAT Catenin delta 1 OS=Rattus norvegicus OX=10116 GN=Ctnnd1 PE=1 SV=1
19	A0A669KB62	2.67e-150	476	888	0.210	0.289	A0A669KB62_HUMAN Catenin delta 1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1
20	F1R6C8	2.12e-142	456	908	0.202	0.273	F1R6C8_DANRE Catenin (cadherin-associated protein), delta 1 OS=Danio rerio OX=7955 GN=ctnnd1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01602 Adaptin_N	47	14.0	Adaptin N terminal region
2	PF00514 Arm	1.2e-44	160.3	Armadillo/beta-catenin-like repeat
3	PF09759 Atx10homo_assoc	65	14.9	Spinocerebellar ataxia type 10 protein domain
4	PF02985 HEAT	0.82	21.1	HEAT repeat
5	PF13646 HEAT_2	0.00081	31.1	HEAT repeats
6	PF13513 HEAT_EZ	80	15.2	HEAT-like repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307134

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326366	0.993	Presenilin-1
2	9606.ENSP00000269141	0.992	Cadherin-2
3	9606.ENSP00000261769	0.986	Cadherin-1
4	9606.ENSP00000027335	0.981	Cadherin-17
5	9606.ENSP00000365745	0.958	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]
6	9606.ENSP00000426632	0.928	Erbin
7	9606.ENSP00000314153	0.909	Transcriptional regulator Kaiso
8	9606.ENSP00000344456	0.906	Catenin beta-1
9	9606.ENSP00000265165	0.901	Lymphoid enhancer-binding factor 1
10	9606.ENSP00000384638	0.868	Catenin alpha-2
11	9606.ENSP00000035383	0.865	Leucine-rich repeat-containing protein 7
12	9606.ENSP00000282111	0.814	Transcription factor 7-like 1
13	9606.ENSP00000340347	0.814	Transcription factor 7
14	9606.ENSP00000371897	0.810	Rho GTPase-activating protein 5
15	9606.ENSP00000402033	0.810	PDZ domain containing 2
16	9606.ENSP00000304669	0.804	Catenin alpha-1
17	9606.ENSP00000400175	0.771	Transforming protein RhoA
18	9606.ENSP00000298854	0.764	43 kDa receptor-associated protein of the synapse
19	9606.ENSP00000382428	0.748	Disks large homolog 4
20	9606.ENSP00000304642	0.741	Reticulophagy regulator 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008013	1.000	beta-catenin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050794	0.979	regulation of cellular process
GO:0032501	0.954	multicellular organismal process
GO:0048856	0.949	anatomical structure development
GO:0007275	0.893	multicellular organism development
GO:0048731	0.831	system development
GO:0071840	0.830	cellular component organization or biogenesis
GO:0034330	0.816	cell junction organization
GO:0007399	0.746	nervous system development
GO:0030154	0.740	cell differentiation
GO:0050896	0.598	response to stimulus
GO:0022008	0.577	neurogenesis
GO:0048699	0.573	generation of neurons
GO:0007154	0.483	cell communication
GO:0010646	0.479	regulation of cell communication
GO:0023051	0.475	regulation of signaling
GO:0023052	0.469	signaling
GO:0007155	0.448	cell adhesion
GO:0051716	0.442	cellular response to stimulus
GO:0007165	0.400	signal transduction
GO:0120036	0.375	plasma membrane bounded cell projection organization
GO:0048518	0.325	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0030054	0.996	cell junction
GO:0043229	0.985	intracellular organelle
GO:0016020	0.977	membrane
GO:0071944	0.971	cell periphery
GO:0005737	0.963	cytoplasm
GO:0005886	0.956	plasma membrane
GO:0043227	0.933	membrane-bounded organelle
GO:0043231	0.881	intracellular membrane-bounded organelle
GO:0045202	0.721	synapse
GO:0005634	0.651	nucleus
GO:0099572	0.649	postsynaptic specialization
GO:0098984	0.647	neuron to neuron synapse
GO:0032279	0.627	asymmetric synapse
GO:0036477	0.410	somatodendritic compartment
GO:0043232	0.401	intracellular non-membrane-bounded organelle
GO:0032991	0.383	protein-containing complex
GO:0005829	0.383	cytosol
GO:0044297	0.312	cell body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]