StarFunc result for job id Q9UQB8

User Input

>input (552 residues)
MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMG
ELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAAL
KKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVS
DGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERA
VQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQESTPIMN
GVTGPDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPKNSYATTENKT
LPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEK
TKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPA
QTASGFKQRPYSVAVPAFSQGLDDYGARSMSRNPFAHVQLKPTVTNDRCDLSAQGPEGRE
HGDGSARTLAGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6GMN2	0.595	0.613	7.821E-69	535	0.913	0.942	Q6GMN2.pdb.gz	BAIP2_RAT Brain-specific angiogenesis inhibitor 1-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Baiap2 PE=1 SV=1
2	AFDB:I3L4C2	0.451	0.451	5.030E-65	553	0.900	0.899	I3L4C2.pdb.gz	I3L4C2_HUMAN Brain-specific angiogenesis inhibitor 1-associated protein 2 OS=Homo sapiens OX=9606 GN=BAIAP2 PE=1 SV=1
3	AFDB:Q9UHR4	0.526	0.565	2.133E-37	511	0.382	0.413	Q9UHR4.pdb.gz	BI2L1_HUMAN Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1 OS=Homo sapiens OX=9606 GN=BAIAP2L1 PE=1 SV=2
4	AFDB:Q6UXY1	0.395	0.412	2.145E-24	529	0.248	0.259	Q6UXY1.pdb.gz	BI2L2_HUMAN Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 OS=Homo sapiens OX=9606 GN=BAIAP2L2 PE=1 SV=1
5	AFDB:Q6P9S0	0.404	0.317	2.021E-13	715	0.199	0.154	Q6P9S0.pdb.gz	MTSS2_MOUSE Protein MTSS 2 OS=Mus musculus OX=10090 GN=Mtss2 PE=1 SV=1
6	AFDB:E1JGY9	0.418	0.247	2.488E-13	950	0.208	0.121	E1JGY9.pdb.gz	E1JGY9_DROME Missing-in-metastasis, isoform D OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
7	AFDB:A0A0B4K822	0.422	0.211	3.577E-13	1136	0.185	0.090	A0A0B4K822.pdb.gz	A0A0B4K822_DROME Missing-in-metastasis, isoform H OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
8	AFDB:A0A0B4JD47	0.412	0.239	4.883E-13	977	0.165	0.093	A0A0B4JD47.pdb.gz	A0A0B4JD47_DROME Missing-in-metastasis, isoform E OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
9	AFDB:Q765P7	0.397	0.299	6.330E-13	747	0.183	0.135	Q765P7.pdb.gz	MTSS2_HUMAN Protein MTSS 2 OS=Homo sapiens OX=9606 GN=MTSS2 PE=1 SV=1
10	AFDB:Q8R1S4	0.404	0.300	6.330E-13	759	0.176	0.128	Q8R1S4.pdb.gz	MTSS1_MOUSE Protein MTSS 1 OS=Mus musculus OX=10090 GN=Mtss1 PE=1 SV=1
11	PDB:6ikoA	0.235	0.350	2.094E-4	303	0.058	0.106	6ikoA.pdb.gz
12	PDB:2dybA	0.098	0.178	6.557E-4	298	0.034	0.064	2dybA.pdb.gz
13	PDB:3hajA	0.099	0.168	1.428E-3	286	0.069	0.133	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
14	PDB:3ehqA	0.099	0.284	1.757E-3	182	0.024	0.071	3ehqA.pdb.gz
15	PDB:2eyzA	0.104	0.181	2.399E-3	304	0.040	0.072	2eyzA.pdb.gz
16	PDB:2lqnA	0.108	0.190	3.110E-3	303	0.036	0.066	2lqnA.pdb.gz
17	PDB:1k0xA	0.099	0.462	3.634E-3	108	0.022	0.111	1k0xA.pdb.gz
18	PDB:1griA	0.109	0.275	4.031E-3	211	0.025	0.066	1griA.pdb.gz
19	PDB:1k9aB	0.095	0.117	9.247E-3	441	0.020	0.025	1k9aB.pdb.gz
20	PDB:3qwyA	0.098	0.305	9.739E-3	170	0.022	0.071	3qwyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B4DWA1	0.0	726	375	0.634	0.933	B4DWA1_HUMAN BAR/IMD domain containing adaptor protein 2 OS=Homo sapiens OX=9606 GN=BAIAP2 PE=1 SV=1
2	I3L4C2	0.0	1037	553	0.926	0.924	I3L4C2_HUMAN Brain-specific angiogenesis inhibitor 1-associated protein 2 OS=Homo sapiens OX=9606 GN=BAIAP2 PE=1 SV=1
3	Q60437	0.0	1018	521	0.886	0.939	BAIP2_CRIGR Brain-specific angiogenesis inhibitor 1-associated protein 2 OS=Cricetulus griseus OX=10029 GN=BAIAP2 PE=1 SV=1
4	Q6GMN2	0.0	1048	535	0.913	0.942	BAIP2_RAT Brain-specific angiogenesis inhibitor 1-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Baiap2 PE=1 SV=1
5	Q8BKX1	0.0	1050	535	0.917	0.946	BAIP2_MOUSE Brain-specific angiogenesis inhibitor 1-associated protein 2 OS=Mus musculus OX=10090 GN=Baiap2 PE=1 SV=2
6	Q9UQB8	0.0	1144	552	1.000	1.000	BAIP2_HUMAN Brain-specific angiogenesis inhibitor 1-associated protein 2 OS=Homo sapiens OX=9606 GN=BAIAP2 PE=1 SV=1
7	I3L3C6	5.75e-149	428	216	0.377	0.963	I3L3C6_HUMAN BAR/IMD domain containing adaptor protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=BAIAP2 PE=1 SV=1
8	Q9UHR4	4.95e-132	396	511	0.391	0.423	BI2L1_HUMAN Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1 OS=Homo sapiens OX=9606 GN=BAIAP2L1 PE=1 SV=2
9	Q80Y61	1.06e-57	202	522	0.284	0.301	BI2L2_MOUSE Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 OS=Mus musculus OX=10090 GN=Baiap2l2 PE=1 SV=1
10	Q6UXY1	1.42e-52	189	529	0.283	0.295	BI2L2_HUMAN Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 OS=Homo sapiens OX=9606 GN=BAIAP2L2 PE=1 SV=1
11	A8JNR3	2.16e-38	151	630	0.139	0.122	A8JNR3_DROME Insulin receptor substrate 53 kDa, isoform B OS=Drosophila melanogaster OX=7227 GN=IRSp53 PE=4 SV=1
12	X2JCT5	2.24e-38	151	646	0.139	0.119	X2JCT5_DROME Insulin receptor substrate 53 kDa, isoform E OS=Drosophila melanogaster OX=7227 GN=IRSp53 PE=4 SV=1
13	A8JNR2	2.52e-38	151	629	0.139	0.122	A8JNR2_DROME Insulin receptor substrate 53 kDa, isoform D OS=Drosophila melanogaster OX=7227 GN=IRSp53 PE=4 SV=2
14	Q8IQE6	5.24e-38	152	1076	0.139	0.072	Q8IQE6_DROME Insulin receptor substrate 53 kDa, isoform A OS=Drosophila melanogaster OX=7227 GN=IRSp53 PE=4 SV=2
15	A0A0B4KEK0	8.31e-11	67.4	1362	0.085	0.035	A0A0B4KEK0_DROME Missing-in-metastasis, isoform N OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
16	Q8R1S4	1.14e-10	66.6	759	0.092	0.067	MTSS1_MOUSE Protein MTSS 1 OS=Mus musculus OX=10090 GN=Mtss1 PE=1 SV=1
17	A0A0B4K7T1	1.20e-10	67.0	1868	0.085	0.025	A0A0B4K7T1_DROME Missing-in-metastasis, isoform J OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
18	A1Z6S0	1.28e-10	67.0	2027	0.085	0.023	A1Z6S0_DROME Missing-in-metastasis, isoform C OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=2
19	A0A0B4KEU9	1.31e-10	66.6	804	0.085	0.058	A0A0B4KEU9_DROME Missing-in-metastasis, isoform K OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
20	A0A0B4JCQ4	1.37e-10	67.0	2009	0.085	0.023	A0A0B4JCQ4_DROME Missing-in-metastasis, isoform G OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03114 BAR	4.2	18.5	BAR domain
2	PF16746 BAR_3	4.3e+02	11.9	BAR domain of APPL family
3	PF08397 IMD	6.4e-100	344.6	IRSp53/MIM homology domain
4	PF15890 Peptidase_Mx1	5.7e+02	11.3	Putative zinc-binding metallo-peptidase
5	PF00616 RasGAP	3.6e+02	12.3	GTPase-activator protein for Ras-like GTPase
6	PF00018 SH3_1	0.15	23.0	SH3 domain
7	PF07653 SH3_2	3e-05	35.1	Variant SH3 domain
8	PF14604 SH3_9	6e-05	34.2	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000316338

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000281172	0.999	Epidermal growth factor receptor kinase substrate 8
2	9606.ENSP00000383118	0.999	Cell division control protein 42 homolog
3	9606.ENSP00000483313	0.999	Wiskott-Aldrich syndrome protein family member 2
4	9606.ENSP00000365312	0.995	Abl interactor 1
5	9606.ENSP00000382428	0.987	Disks large homolog 4
6	9606.ENSP00000451828	0.985	RAC-alpha serine/threonine-protein kinase
7	9606.ENSP00000223023	0.984	Neural Wiskott-Aldrich syndrome protein
8	9606.ENSP00000354251	0.981	Nck-associated protein 1
9	9606.ENSP00000348461	0.967	Ras-related C3 botulinum toxin substrate 1
10	9606.ENSP00000444645	0.964	Cytoplasmic FMR1-interacting protein 2
11	9606.ENSP00000376368	0.956	Wiskott-Aldrich syndrome protein family member 1
12	9606.ENSP00000245932	0.945	Vasodilator-stimulated phosphoprotein
13	9606.ENSP00000355809	0.945	Protein enabled homolog
14	9606.ENSP00000430945	0.937	Adhesion G protein-coupled receptor B1
15	9606.ENSP00000432472	0.935	Protein BRICK1
16	9606.ENSP00000481038	0.922	Cytoplasmic FMR1-interacting protein 1
17	9606.ENSP00000365891	0.919	Wiskott-Aldrich syndrome protein
18	9606.ENSP00000294129	0.912	NCK-interacting protein with SH3 domain
19	9606.ENSP00000361423	0.912	Tyrosine-protein kinase ABL1
20	9606.ENSP00000263025	0.906	Mitogen-activated protein kinase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019904	0.514	protein domain specific binding
GO:0042802	0.457	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0016043	0.993	cellular component organization
GO:0050896	0.982	response to stimulus
GO:0007154	0.976	cell communication
GO:0023052	0.974	signaling
GO:0051716	0.967	cellular response to stimulus
GO:0007165	0.953	signal transduction
GO:0032501	0.933	multicellular organismal process
GO:0048856	0.929	anatomical structure development
GO:0030030	0.919	cell projection organization
GO:0007275	0.918	multicellular organism development
GO:0032970	0.914	regulation of actin filament-based process
GO:0051128	0.907	regulation of cellular component organization
GO:0120036	0.901	plasma membrane bounded cell projection organization
GO:0048731	0.851	system development
GO:0048518	0.841	positive regulation of biological process
GO:0023051	0.838	regulation of signaling
GO:0010646	0.838	regulation of cell communication
GO:0030182	0.837	neuron differentiation
GO:0048522	0.803	positive regulation of cellular process
GO:0065008	0.801	regulation of biological quality
GO:0050793	0.770	regulation of developmental process
GO:0007167	0.753	enzyme-linked receptor protein signaling pathway
GO:0009653	0.729	anatomical structure morphogenesis
GO:0009719	0.716	response to endogenous stimulus
GO:0048468	0.701	cell development
GO:1901652	0.653	response to peptide
GO:0071495	0.650	cellular response to endogenous stimulus
GO:0031175	0.647	neuron projection development
GO:0022603	0.641	regulation of anatomical structure morphogenesis
GO:0070887	0.640	cellular response to chemical stimulus
GO:0000902	0.637	cell morphogenesis
GO:0022604	0.633	regulation of cell morphogenesis
GO:0051179	0.586	localization
GO:0006996	0.552	organelle organization
GO:0071417	0.547	cellular response to organonitrogen compound
GO:1901701	0.535	cellular response to oxygen-containing compound
GO:0050804	0.505	modulation of chemical synaptic transmission
GO:0051130	0.474	positive regulation of cellular component organization
GO:0009605	0.456	response to external stimulus
GO:0070848	0.450	response to growth factor
GO:0048583	0.389	regulation of response to stimulus
GO:0120035	0.377	regulation of plasma membrane bounded cell projection organization
GO:0048519	0.376	negative regulation of biological process
GO:0051493	0.375	regulation of cytoskeleton organization
GO:0007169	0.344	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0048523	0.343	negative regulation of cellular process
GO:0032956	0.337	regulation of actin cytoskeleton organization
GO:0007010	0.325	cytoskeleton organization
GO:0009966	0.320	regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005886	0.999	plasma membrane
GO:0030054	0.995	cell junction
GO:0043227	0.991	membrane-bounded organelle
GO:0043232	0.989	intracellular non-membrane-bounded organelle
GO:0005576	0.889	extracellular region
GO:0031982	0.864	vesicle
GO:0005856	0.850	cytoskeleton
GO:0005615	0.800	extracellular space
GO:0042995	0.750	cell projection
GO:1903561	0.712	extracellular vesicle
GO:0070062	0.686	extracellular exosome
GO:0120025	0.668	plasma membrane bounded cell projection
GO:0043231	0.666	intracellular membrane-bounded organelle
GO:0045202	0.622	synapse
GO:0015629	0.605	actin cytoskeleton
GO:0070161	0.400	anchoring junction
GO:0043005	0.396	neuron projection
GO:0031410	0.324	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]