StarFunc result for job id Q9UQD0

User Input

>input (1980 residues)
MAARLLAPPGPDSFKPFTPESLANIERRIAESKLKKPPKADGSHREDDEDSKPKPNSDLE
AGKSLPFIYGDIPQGLVAVPLEDFDPYYLTQKTFVVLNRGKTLFRFSATPALYILSPFNL
IRRIAIKILIHSVFSMIIMCTILTNCVFMTFSNPPDWSKNVEYTFTGIYTFESLVKIIAR
GFCIDGFTFLRDPWNWLDFSVIMMAYITEFVNLGNVSALRTFRVLRALKTISVIPGLKTI
VGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCVVWPINFNESYLENGTKGF
DWEEYINNKTNFYTVPGMLEPLLCGNSSDAGQCPEGYQCMKAGRNPNYGYTSFDTFSWAF
LALFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFVGSFYLVNLILAVVAMAYEEQNQA
TLEEAEQKEAEFKAMLEQLKKQQEEAQAAAMATSAGTVSEDAIEEEGEEGGGSPRSSSEI
SKLSSKSAKERRNRRKKRKQKELSEGEEKGDPEKVFKSESEDGMRRKAFRLPDNRIGRKF
SIMNQSLLSIPGSPFLSRHNSKSSIFSFRGPGRFRDPGSENEFADDEHSTVEESEGRRDS
LFIPIRARERRSSYSGYSGYSQGSRSSRIFPSLRRSVKRNSTVDCNGVVSLIGGPGSHIG
GRLLPEATTEVEIKKKGPGSLLVSMDQLASYGRKDRINSIMSVVTNTLVEELEESQRKCP
PCWYKFANTFLIWECHPYWIKLKEIVNLIVMDPFVDLAITICIVLNTLFMAMEHHPMTPQ
FEHVLAVGNLVFTGIFTAEMFLKLIAMDPYYYFQEGWNIFDGFIVSLSLMELSLADVEGL
SVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKS
YKECVCKINQDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVFMMV
MVIGNLVVLNLFLALLLSSFSADNLAATDDDGEMNNLQISVIRIKKGVAWTKLKVHAFMQ
AHFKQREADEVKPLDELYEKKANCIANHTGADIHRNGDFQKNGNGTTSGIGSSVEKYIID
EDHMSFINNPNLTVRVPIAVGESDFENLNTEDVSSESDPEGSKDKLDDTSSSEGSTIDIK
PEVEEVPVEQPEEYLDPDACFTEGCVQRFKCCQVNIEEGLGKSWWILRKTCFLIVEHNWF
ETFIIFMILLSSGALAFEDIYIEQRKTIRTILEYADKVFTYIFILEMLLKWTAYGFVKFF
TNAWCWLDFLIVAVSLVSLIANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNAL
VGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYHYCFNETSEIRFEIEDVNNKTECEKLM
EGNNTEIRWKNVKINFDNVGAGYLALLQVATFKGWMDIMYAAVDSRKPDEQPKYEDNIYM
YIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNAMKKLGSKKP
QKPIPRPLNKIQGIVFDFVTQQAFDIVIMMLICLNMVTMMVETDTQSKQMENILYWINLV
FVIFFTCECVLKMFALRHYYFTIGWNIFDFVVVILSIVGMFLADIIEKYFVSPTLFRVIR
LARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIFSIFGMSNFAYVKHEA
GIDDMFNFETFGNSMICLFQITTSAGWDGLLLPILNRPPDCSLDKEHPGSGFKGDCGNPS
VGIFFFVSYIIISFLIVVNMYIAIILENFSVATEESADPLSEDDFETFYEIWEKFDPDAT
QFIEYCKLADFADALEHPLRVPKPNTIELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSG
ELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICKKT
TSNKLENGGTHREKKESTPSTASLPSYDSVTKPEKEKQQRAEEGRRERAKRQKEVRESKC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6agfA	0.564	0.976	0.000	1138	0.481	0.837	6agfA.pdb.gz	Structure of the human voltage-gated sodium channel Nav1.4 in complex with beta 1.
2	PDB:6j8eA	0.565	0.976	0.000	1139	0.504	0.875	6j8eA.pdb.gz	Molecular basis for pore blockade of human Na+channel Nav1.2 by the mu-conotoxin KIIIA.
3	PDB:6j8gA	0.561	0.966	0.000	1140	0.474	0.823	6j8gA.pdb.gz	Structures of human Nav1.7 channel in complex with auxiliary subunits and animal toxins.
4	PDB:7w9lA	0.651	0.901	0.000	1420	0.577	0.804	7w9lA.pdb.gz	High-resolution structures of human Na v 1.7 reveal gating modulation through alpha-pi helical transition of S6 IV.
5	PDB:7xveA	0.592	0.900	0.000	1276	0.515	0.799	7xveA.pdb.gz	Unwinding and spiral sliding of S4 and domain rotation of VSD during the electromechanical coupling in Na v 1.7.
6	AFDB:A0A2R8QLY1	0.860	0.873	0.000	1949	0.823	0.836	A0A2R8QLY1.pdb.gz
7	AFDB:B1AWN6	0.839	0.829	0.000	2006	0.770	0.760	B1AWN6.pdb.gz	SCN2A_MOUSE Sodium channel protein type 2 subunit alpha OS=Mus musculus OX=10090 GN=Scn2a PE=1 SV=1
8	AFDB:F1LQQ7	0.717	0.829	0.000	1704	0.404	0.469	F1LQQ7.pdb.gz	F1LQQ7_RAT Sodium channel protein OS=Rattus norvegicus OX=10116 GN=Scn7a PE=1 SV=4
9	AFDB:F1QXF5	0.830	0.824	0.000	1996	0.752	0.746	F1QXF5.pdb.gz	F1QXF5_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=scn1lab PE=3 SV=1
10	AFDB:P15389	0.783	0.768	0.000	2019	0.629	0.617	P15389.pdb.gz	SCN5A_RAT Sodium channel protein type 5 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn5a PE=1 SV=1
11	AFDB:Q15858	0.822	0.818	0.000	1988	0.714	0.711	Q15858.pdb.gz	SCN9A_HUMAN Sodium channel protein type 9 subunit alpha OS=Homo sapiens OX=9606 GN=SCN9A PE=1 SV=3
12	AFDB:Q9ER60	0.774	0.832	0.000	1841	0.641	0.690	Q9ER60.pdb.gz	SCN4A_MOUSE Sodium channel protein type 4 subunit alpha OS=Mus musculus OX=10090 GN=Scn4a PE=1 SV=1
13	AFDB:Q9UQD0	1.000	1.000	0.000	1980	1.000	1.000	Q9UQD0.pdb.gz	SCN8A_HUMAN Sodium channel protein type 8 subunit alpha OS=Homo sapiens OX=9606 GN=SCN8A PE=1 SV=1
14	PDB:7we4A	0.547	0.957	1.832E-97	1122	0.401	0.707	7we4A.pdb.gz	Structural basis for high-voltage activation and subtype-specific inhibition of human Na v 1.8.
15	PDB:6lqaB	0.566	0.965	2.593E-97	1151	0.456	0.784	6lqaB.pdb.gz	Structural Basis for Pore Blockade of the Human Cardiac Sodium Channel Na v 1.5 by the Antiarrhythmic Drug Quinidine*.
16	PDB:6uz3A	0.554	0.966	1.231E-94	1126	0.446	0.785	6uz3A.pdb.gz	Structure of the Cardiac Sodium Channel.
17	PDB:7tj9A	0.541	0.955	1.419E-80	1111	0.319	0.568	7tj9A.pdb.gz	Structure-guided unlocking of Na X reveals a non-selective tetrodotoxin-sensitive cation channel.
18	PDB:7mixA	0.533	0.781	2.647E-49	1326	0.188	0.281	7mixA.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.
19	AFDB:Q91ZR5	0.113	0.305	4.957E-7	686	0.048	0.138	Q91ZR5.pdb.gz	CTSR1_MOUSE Cation channel sperm-associated protein 1 OS=Mus musculus OX=10090 GN=Catsper1 PE=1 SV=1
20	AFDB:Q8NEC5	0.114	0.273	6.158E-7	780	0.049	0.126	Q8NEC5.pdb.gz	CTSR1_HUMAN Cation channel sperm-associated protein 1 OS=Homo sapiens OX=9606 GN=CATSPER1 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MT39	2352	1962	0.631	0.637	A0A0A0MT39_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
2	A0A0R4IUM7	2406	1955	0.639	0.648	A0A0R4IUM7_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=Nav1.1 PE=3 SV=2
3	A0A1B0GVX7	2333	1618	0.621	0.760	A0A1B0GVX7_HUMAN Sodium voltage-gated channel alpha subunit 1 OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
4	A0A1W2PPJ3	2908	1998	0.768	0.761	A0A1W2PPJ3_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
5	A0A286YEQ8	1851	1915	0.512	0.530	A0A286YEQ8_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
6	A0A286YF26	2912	1997	0.771	0.764	A0A286YF26_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
7	A0A590UK43	3989	1939	0.978	0.999	A0A590UK43_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN8A PE=1 SV=1
8	A0A8I6GH51	1134	1672	0.298	0.353	A0A8I6GH51_RAT Sodium channel protein OS=Rattus norvegicus OX=10116 GN=Scn7a PE=3 SV=1
9	A2APX8	2916	2009	0.767	0.756	SCN1A_MOUSE Sodium channel protein type 1 subunit alpha OS=Mus musculus OX=10090 GN=Scn1a PE=1 SV=1
10	A2ASI5	2752	1947	0.744	0.757	SCN3A_MOUSE Sodium channel protein type 3 subunit alpha OS=Mus musculus OX=10090 GN=Scn3a PE=1 SV=1
11	B1AWN6	2951	2006	0.763	0.753	SCN2A_MOUSE Sodium channel protein type 2 subunit alpha OS=Mus musculus OX=10090 GN=Scn2a PE=1 SV=1
12	B1AYL1	1186	1681	0.312	0.368	B1AYL1_MOUSE Sodium channel protein OS=Mus musculus OX=10090 GN=Scn7a PE=1 SV=1
13	E9PG18	1121	1998	0.311	0.308	E9PG18_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=3 SV=1
14	E9PHB6	1121	1983	0.311	0.311	E9PHB6_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
15	F1LQQ7	1152	1680	0.303	0.357	F1LQQ7_RAT Sodium channel protein OS=Rattus norvegicus OX=10116 GN=Scn7a PE=1 SV=4
16	F1QXF5	2870	1996	0.752	0.746	F1QXF5_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=scn1lab PE=3 SV=1
17	H9KVD2	1121	2016	0.311	0.306	H9KVD2_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
18	K4DIA1	2352	1962	0.630	0.636	K4DIA1_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=3 SV=1
19	O08562	2642	1984	0.709	0.708	SCN9A_RAT Sodium channel protein type 9 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn9a PE=1 SV=1
20	O88420	4030	1978	0.986	0.987	SCN8A_RAT Sodium channel protein type 8 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn8a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16905 GPHH	6.5	18.0	Voltage-dependent L-type calcium channel, IQ-associated
2	PF00520 Ion_trans	6e-256	856.0	Ion transport protein
3	PF00612 IQ	0.43	21.5	IQ calmodulin-binding motif
4	PF06512 Na_trans_assoc	1.7e-53	193.5	Sodium ion transport-associated
5	PF11933 Na_trans_cytopl	3.6e-41	152.6	Cytoplasmic domain of voltage-gated Na+ ion channel
6	PF08016 PKD_channel	0.00022	32.3	Polycystin cation channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346534

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365301	0.991	Fibroblast growth factor 14
2	9606.ENSP00000280772	0.976	Ankyrin-3
3	9606.ENSP00000263373	0.906	Spectrin beta chain, non-erythrocytic 4
4	9606.ENSP00000344786	0.906	Neurofascin
5	9606.ENSP00000322460	0.901	Sodium channel subunit beta-4
6	9606.ENSP00000352035	0.896	Potassium voltage-gated channel subfamily KQT member 2
7	9606.ENSP00000264638	0.875	Contactin-associated protein 1
8	9606.ENSP00000396915	0.869	Sodium channel subunit beta-1
9	9606.ENSP00000278947	0.865	Sodium channel subunit beta-2
10	9606.ENSP00000349588	0.856	Ankyrin-2
11	9606.ENSP00000373648	0.843	Potassium voltage-gated channel subfamily KQT member 3
12	9606.ENSP00000368314	0.841	Neuronal cell adhesion molecule
13	9606.ENSP00000376523	0.834	Sodium channel subunit beta-3
14	9606.ENSP00000371985	0.813	Potassium voltage-gated channel subfamily A member 1
15	9606.ENSP00000433109	0.811	Potassium voltage-gated channel subfamily A member 2
16	9606.ENSP00000361824	0.775	Spectrin alpha chain, non-erythrocytic 1
17	9606.ENSP00000356265	0.767	Neuron navigator 1
18	9606.ENSP00000357901	0.766	Sodium channel modifier 1
19	9606.ENSP00000322390	0.758	Fibroblast growth factor 13
20	9606.ENSP00000296755	0.756	Microtubule-associated protein 1B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005248	1.000	voltage-gated sodium channel activity
GO:0005515	0.996	protein binding
GO:0022839	0.433	monoatomic ion gated channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0032501	0.982	multicellular organismal process
GO:0065007	0.969	biological regulation
GO:0051179	0.963	localization
GO:0050896	0.936	response to stimulus
GO:0030001	0.923	metal ion transport
GO:0003008	0.917	system process
GO:0032502	0.896	developmental process
GO:0048856	0.889	anatomical structure development
GO:0006814	0.859	sodium ion transport
GO:0007154	0.830	cell communication
GO:0007275	0.823	multicellular organism development
GO:0019226	0.806	transmission of nerve impulse
GO:0050789	0.691	regulation of biological process
GO:0048731	0.648	system development
GO:0042391	0.634	regulation of membrane potential
GO:0007399	0.600	nervous system development
GO:0034220	0.545	monoatomic ion transmembrane transport
GO:0098662	0.527	inorganic cation transmembrane transport
GO:0098655	0.496	monoatomic cation transmembrane transport
GO:0050794	0.458	regulation of cellular process
GO:0007600	0.391	sensory perception
GO:0007610	0.373	behavior
GO:0001508	0.302	action potential

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0034703	0.998	cation channel complex
GO:0098797	0.997	plasma membrane protein complex
GO:0034706	0.979	sodium channel complex
GO:0001518	0.953	voltage-gated sodium channel complex
GO:0005622	0.867	intracellular anatomical structure
GO:0043226	0.742	organelle
GO:0005737	0.701	cytoplasm
GO:0043229	0.644	intracellular organelle
GO:0043227	0.430	membrane-bounded organelle
GO:0030054	0.332	cell junction
GO:0043231	0.308	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)

[back to server]