StarFunc result for job id Q9UQE7

User Input

>input (1217 residues)
MYIKQVIIQGFRSYRDQTIVDPFSSKHNVIVGRNGSGKSNFFYAIQFVLSDEFSHLRPEQ
RLALLHEGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKND
VMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMK
ETEGKREKINELLKYIEERLHTLEEEKEELAQYQKWDKMRRALEYTIYNQELNETRAKLD
ELSAKRETSGEKSRQLRDAQQDARDKMEDIERQVRELKTKISAMKEEKEQLSAERQEQIK
QRTKLELKAKDLQDELAGNSEQRKRLLKERQKLLEKIEEKQKELAETEPKFNSVKEKEER
GIARLAQATQERTDLYAKQGRGSQFTSKEERDKWIKKELKSLDQAINDKKRQIAAIHKDL
EDTEANKEKNLEQYNKLDQDLNEVKARVEELDRKYYEVKNKKDELQSERNYLWREENAEQ
QALAAKREDLEKKQQLLRAATGKAILNGIDSINKVLDHFRRKGINQHVQNGYHGIVMNNF
ECEPAFYTCVEVTAGNRLFYHIVDSDEVSTKILMEFNKMNLPGEVTFLPLNKLDVRDTAY
PETNDAIPMISKLRYNPRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSH
RGALTGGYYDTRKSRLELQKDVRKAEEELGELEAKLNENLRRNIERINNEIDQLMNQMQQ
IETQQRKFKASRDSILSEMKMLKEKRQQSEKTFMPKQRSLQSLEASLHAMESTRESLKAE
LGTDLLSQLSLEDQKRVDALNDEIRQLQQENRQLLNERIKLEGIITRVETYLNENLRKRL
DQVEQELNELRETEGGTVLTATTSELEAINKRVKDTMARSEDLDNSIDKTEAGIKELQKS
MERWKNMEKEHMDAINHDTKELEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTL
SLKQLFRKLEQCNTELKKYSHVNKKALDQFVNFSEQKEKLIKRQEELDRGYKSIMELMNV
LELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDVEGSQSQDEGEGSGESERG
SGSQSSVPSVDQFTGVGIRVSFTGKQGEMREMQQLSGGQKSLVALALIFAIQKCDPAPFY
LFDEIDQALDAQHRKAVSDMIMELAVHAQFITTTFRPELLESADKFYGVKFRNKVSHIDV
ITAEMAKDFVEDDTTHG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2FDA8	0.498	0.482	0.000	1261	0.394	0.381	B2FDA8.pdb.gz	SMC3_CAEEL Structural maintenance of chromosomes protein 3 OS=Caenorhabditis elegans OX=6239 GN=smc-3 PE=1 SV=1
2	AFDB:O42649	0.500	0.509	0.000	1194	0.394	0.402	O42649.pdb.gz	SMC3_SCHPO Structural maintenance of chromosomes protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psm3 PE=1 SV=1
3	AFDB:Q00737	0.466	0.466	0.000	1215	0.412	0.412	Q00737.pdb.gz	SUDA_EMENI Chromosome segregation protein sudA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=sudA PE=2 SV=3
4	AFDB:Q24098	0.513	0.507	0.000	1231	0.528	0.522	Q24098.pdb.gz	Q24098_DROME Structural maintenance of chromosomes protein OS=Drosophila melanogaster OX=7227 GN=SMC3 PE=2 SV=1
5	AFDB:Q56YN8	0.414	0.417	0.000	1204	0.396	0.400	Q56YN8.pdb.gz	SMC3_ARATH Structural maintenance of chromosomes protein 3 OS=Arabidopsis thaliana OX=3702 GN=SMC3 PE=2 SV=1
6	AFDB:Q8AWB8	0.557	0.557	0.000	1217	0.993	0.993	Q8AWB8.pdb.gz	Q8AWB8_CHICK Structural maintenance of chromosomes protein OS=Gallus gallus OX=9031 GN=SMC3 PE=2 SV=1
7	AFDB:P47037	0.468	0.464	7.118E-98	1230	0.316	0.312	P47037.pdb.gz	SMC3_YEAST Structural maintenance of chromosomes protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMC3 PE=1 SV=1
8	AFDB:Q75FB3	0.531	0.525	1.072E-95	1231	0.308	0.305	Q75FB3.pdb.gz	Q75FB3_EREGS Structural maintenance of chromosomes protein OS=Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=AGOS_AAL182W PE=1 SV=1
9	AFDB:Q57UB5	0.424	0.430	6.932E-92	1199	0.299	0.304	Q57UB5.pdb.gz	Q57UB5_TRYB2 Structural maintenance of chromosomes protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.6E7.170 PE=3 SV=1
10	PDB:6wg3B	0.309	0.528	2.090E-85	693	0.568	0.997	6wg3B.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
11	AFDB:Q8TZY2	0.304	0.314	1.283E-68	1177	0.242	0.250	Q8TZY2.pdb.gz	SMC_PYRFU Chromosome partition protein Smc OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=smc PE=1 SV=2
12	PDB:6yvuB	0.259	0.264	6.326E-50	1191	0.203	0.207	6yvuB.pdb.gz
13	PDB:6wgeB	0.313	0.742	8.772E-50	490	0.401	0.996	6wgeB.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
14	PDB:6yvuA	0.235	0.252	6.249E-37	1127	0.200	0.216	6yvuA.pdb.gz
15	PDB:7ogtB	0.368	0.576	2.580E-28	708	0.143	0.246	7ogtB.pdb.gz
16	PDB:7qcdA	0.203	0.237	3.530E-27	1028	0.143	0.169	7qcdA.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
17	PDB:7qcdB	0.248	0.297	1.094E-25	998	0.152	0.185	7qcdB.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
18	PDB:6wg3A	0.240	0.505	2.076E-24	561	0.130	0.282	6wg3A.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
19	PDB:6yufC	0.281	0.705	1.171E-22	456	0.217	0.579	6yufC.pdb.gz	A Structure-Based Mechanism for DNA Entry into the Cohesin Ring.
20	PDB:7ogtA	0.158	0.214	9.049E-16	688	0.066	0.116	7ogtA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2FDA8	0.0	833	1261	0.413	0.399	SMC3_CAEEL Structural maintenance of chromosomes protein 3 OS=Caenorhabditis elegans OX=6239 GN=smc-3 PE=1 SV=1
2	O42649	0.0	827	1194	0.395	0.403	SMC3_SCHPO Structural maintenance of chromosomes protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psm3 PE=1 SV=1
3	O93309	0.0	2381	1209	0.959	0.965	SMC3_XENLA Structural maintenance of chromosomes protein 3 OS=Xenopus laevis OX=8355 GN=smc3 PE=1 SV=2
4	P47037	0.0	642	1230	0.339	0.335	SMC3_YEAST Structural maintenance of chromosomes protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMC3 PE=1 SV=1
5	P97690	0.0	2413	1191	0.970	0.992	SMC3_RAT Structural maintenance of chromosomes protein 3 OS=Rattus norvegicus OX=10116 GN=Smc3 PE=1 SV=1
6	Q00737	0.0	910	1215	0.419	0.420	SUDA_EMENI Chromosome segregation protein sudA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=sudA PE=2 SV=3
7	Q24098	0.0	1246	1231	0.535	0.529	Q24098_DROME Structural maintenance of chromosomes protein OS=Drosophila melanogaster OX=7227 GN=SMC3 PE=2 SV=1
8	Q56YN8	0.0	879	1204	0.399	0.403	SMC3_ARATH Structural maintenance of chromosomes protein 3 OS=Arabidopsis thaliana OX=3702 GN=SMC3 PE=2 SV=1
9	Q75FB3	0.0	602	1231	0.325	0.322	Q75FB3_EREGS Structural maintenance of chromosomes protein OS=Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=AGOS_AAL182W PE=1 SV=1
10	Q803N2	0.0	2318	1216	0.952	0.952	Q803N2_DANRE Structural maintenance of chromosomes protein OS=Danio rerio OX=7955 GN=wu:fc30d07 PE=1 SV=1
11	Q8AWB8	0.0	2471	1217	0.993	0.993	Q8AWB8_CHICK Structural maintenance of chromosomes protein OS=Gallus gallus OX=9031 GN=SMC3 PE=2 SV=1
12	Q9CW03	0.0	2487	1217	0.999	0.999	SMC3_MOUSE Structural maintenance of chromosomes protein 3 OS=Mus musculus OX=10090 GN=Smc3 PE=1 SV=2
13	Q9UQE7	0.0	2488	1217	1.000	1.000	SMC3_HUMAN Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2
14	Q9VXE9	0.0	1250	1200	0.536	0.543	Q9VXE9_DROME Structural maintenance of chromosomes protein OS=Drosophila melanogaster OX=7227 GN=SMC3 PE=1 SV=2
15	Q57UB5	1.62e-175	552	1199	0.319	0.324	Q57UB5_TRYB2 Structural maintenance of chromosomes protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.6E7.170 PE=3 SV=1
16	P50533	5.28e-72	265	1203	0.265	0.268	SMC2_XENLA Structural maintenance of chromosomes protein 2 OS=Xenopus laevis OX=8355 GN=smc2 PE=1 SV=1
17	O95347	2.85e-70	259	1197	0.263	0.267	SMC2_HUMAN Structural maintenance of chromosomes protein 2 OS=Homo sapiens OX=9606 GN=SMC2 PE=1 SV=2
18	P41003	1.32e-64	242	1172	0.256	0.266	SMC2_SCHPO Structural maintenance of chromosomes protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cut14 PE=1 SV=2
19	Q8TZY2	3.64e-55	212	1177	0.197	0.204	SMC_PYRFU Chromosome partition protein Smc OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=smc PE=1 SV=2
20	P38989	1.21e-51	201	1170	0.241	0.250	SMC2_YEAST Structural maintenance of chromosomes protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMC2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13175 AAA_15	2.5e-14	65.2	AAA ATPase domain
2	PF13304 AAA_21	1.5e-06	39.8	AAA domain, putative AbiEii toxin, Type IV TA system
3	PF13476 AAA_23	2.1e-05	36.6	AAA domain
4	PF13555 AAA_29	19	16.4	P-loop containing region of AAA domain
5	PF14942 Muted	28	16.4	Organelle biogenesis, Muted-like protein
6	PF06470 SMC_hinge	1.5e-17	75.4	SMC proteins Flexible Hinge Domain
7	PF02463 SMC_N	1.5e-60	215.9	RecF/RecN/SMC N terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008567414.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008561392.1	0.999	Double-strand-break repair protein rad21 homolog
2	482537.XP_008561449.1	0.999	Cohesin subunit SA-1-like
3	482537.XP_008562460.1	0.999	Cohesin subunit SA-2 isoform X1
4	482537.XP_008572948.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 mRNAs, 4 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
5	482537.XP_008577140.1	0.999	Structural maintenance of chromosomes protein 6
6	482537.XP_008587538.1	0.999	Cohesin subunit SA-1
7	482537.XP_008570554.1	0.997	Meiotic recombination protein REC8 homolog
8	482537.XP_008580969.1	0.997	Double-strand-break repair protein rad21-like protein 1 isoform X1
9	482537.XP_008588606.1	0.997	Cohesin subunit SA-3
10	482537.XP_008564151.1	0.993	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 13 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
11	482537.XP_008573069.1	0.993	Separin
12	482537.XP_008568539.1	0.990	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 2 bases in 1 codon
13	482537.XP_008562192.1	0.986	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
14	482537.XP_008580007.1	0.986	Sister chromatid cohesion protein PDS5 homolog B
15	482537.XP_008587630.1	0.985	Structural maintenance of chromosomes protein 2
16	482537.XP_008568269.1	0.984	Structural maintenance of chromosomes protein 5
17	482537.XP_008579431.1	0.983	Structural maintenance of chromosomes protein 4
18	482537.XP_008563090.1	0.982	Structural maintenance of chromosomes protein 2-like
19	482537.XP_008574105.1	0.981	N-acetyltransferase ESCO2
20	482537.XP_008586740.1	0.980	N-acetyltransferase ESCO1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.997	transcription regulator activity
GO:0000981	0.994	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:1901363	0.886	heterocyclic compound binding
GO:0097159	0.886	organic cyclic compound binding
GO:0003676	0.847	nucleic acid binding
GO:0003677	0.822	DNA binding
GO:0003682	0.651	chromatin binding
GO:0044877	0.493	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0007049	0.990	cell cycle
GO:0016043	0.990	cellular component organization
GO:0050794	0.988	regulation of cellular process
GO:0019222	0.988	regulation of metabolic process
GO:0060255	0.984	regulation of macromolecule metabolic process
GO:0080090	0.981	regulation of primary metabolic process
GO:0051171	0.981	regulation of nitrogen compound metabolic process
GO:0031323	0.976	regulation of cellular metabolic process
GO:0006996	0.975	organelle organization
GO:0019219	0.970	regulation of nucleobase-containing compound metabolic process
GO:0051276	0.942	chromosome organization
GO:0048285	0.941	organelle fission
GO:0032502	0.936	developmental process
GO:0000280	0.929	nuclear division
GO:0007062	0.926	sister chromatid cohesion
GO:0098813	0.895	nuclear chromosome segregation
GO:0048856	0.872	anatomical structure development
GO:0000278	0.865	mitotic cell cycle
GO:1903047	0.847	mitotic cell cycle process
GO:0000819	0.807	sister chromatid segregation
GO:0140014	0.799	mitotic nuclear division
GO:0000070	0.757	mitotic sister chromatid segregation
GO:0006357	0.736	regulation of transcription by RNA polymerase II
GO:0007064	0.609	mitotic sister chromatid cohesion
GO:0031101	0.558	fin regeneration
GO:0000003	0.406	reproduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.999	protein-containing complex
GO:0005694	0.999	chromosome
GO:0044815	0.978	DNA packaging complex
GO:0008278	0.925	cohesin complex
GO:0005737	0.706	cytoplasm
GO:0000793	0.687	condensed chromosome
GO:0000228	0.548	nuclear chromosome
GO:0005829	0.451	cytosol
GO:0005856	0.348	cytoskeleton
GO:0000795	0.348	synaptonemal complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]