StarFunc result for job id Q9UQF2

User Input

>input (711 residues)
MAERESGGLGGGAASPPAASPFLGLHIASPPNFRLTHDISLEEFEDEDLSEITDECGISL
QCKDTLSLRPPRAGLLSAGGGGAGSRLQAEMLQMDLIDATGDTPGAEDDEEDDDEERAAR
RPGAGPPKAESGQEPASRGQGQSQGQSQGPGSGDTYRPKRPTTLNLFPQVPRSQDTLNNN
SLGKKHSWQDRVSRSSSPLKTGEQTPPHEHICLSDELPPQSGPAPTTDRGTSTDSPCRRS
TATQMAPPGGPPAAPPGGRGHSHRDRIHYQADVRLEATEEIYLTPVQRPPDAAEPTSAFL
PPTESRMSVSSDPDPAAYPSTAGRPHPSISEEEEGFDCLSSPERAEPPGGGWRGSLGEPP
PPPRASLSSDTSALSYDSVKYTLVVDEHAQLELVSLRPCFGDYSDESDSATVYDNCASVS
SPYESAIGEEYEEAPRPQPPACLSEDSTPDEPDVHFSKKFLNVFMSGRSRSSSAESFGLF
SCIINGEEQEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFP
AYYAIEVTKEPEHMAALAKNSDWVDQFRVKFLGSVQVPYHKGNDVLCAAMQKIATTRRLT
VHFNPPSSCVLEISVRGVKIGVKADDSQEAKGNKCSHFFQLKNISFCGYHPKNNKYFGFI
TKHPADHRFACHVFVSEDSTKALAESVGRAFQQFYKQFVEYTCPTEDIYLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UQF2	0.999	0.999	0.000	711	1.000	1.000	Q9UQF2.pdb.gz	JIP1_HUMAN C-Jun-amino-terminal kinase-interacting protein 1 OS=Homo sapiens OX=9606 GN=MAPK8IP1 PE=1 SV=1
2	AFDB:Q8IZW8	0.153	0.152	1.593E-7	715	0.181	0.180	Q8IZW8.pdb.gz	TENS4_HUMAN Tensin-4 OS=Homo sapiens OX=9606 GN=TNS4 PE=1 SV=3
3	AFDB:X2JE74	0.159	0.101	5.745E-7	1170	0.184	0.112	X2JE74.pdb.gz	X2JE74_DROME X11L, isoform F OS=Drosophila melanogaster OX=7227 GN=X11L PE=4 SV=1
4	AFDB:Q63HR2	0.147	0.079	8.974E-7	1409	0.172	0.087	Q63HR2.pdb.gz	TENS2_HUMAN Tensin-2 OS=Homo sapiens OX=9606 GN=TNS2 PE=1 SV=2
5	AFDB:Q9HBL0	0.153	0.066	1.482E-6	1735	0.166	0.068	Q9HBL0.pdb.gz	TENS1_HUMAN Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=3
6	AFDB:Q9W2S5	0.165	0.059	1.567E-6	2139	0.159	0.053	Q9W2S5.pdb.gz	Q9W2S5_DROME X11Lbeta, isoform A OS=Drosophila melanogaster OX=7227 GN=X11Lbeta PE=1 SV=5
7	PDB:7r04B	0.123	0.043	2.653E-4	2229	0.023	0.007	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
8	PDB:5yqrA	0.093	0.226	5.477E-4	268	0.013	0.034	5yqrA.pdb.gz
9	PDB:7r04A	0.124	0.041	8.092E-4	2326	0.023	0.007	7r04A.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
10	PDB:3cm1A	0.100	0.359	1.011E-3	137	0.024	0.124	3cm1A.pdb.gz
11	AFDB:A0A0U1RQE4	0.085	0.060	1.864E-3	1047	0.155	0.105	A0A0U1RQE4.pdb.gz	A0A0U1RQE4_HUMAN SH3 domain containing 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=1
12	PDB:7r03B	0.126	0.044	1.868E-3	2246	0.023	0.007	7r03B.pdb.gz
13	PDB:7mp5A	0.118	0.055	2.088E-3	1629	0.025	0.011	7mp5A.pdb.gz
14	AFDB:Q06681	0.123	0.065	3.442E-3	1438	0.153	0.076	Q06681.pdb.gz	YSP2_YEAST Membrane-anchored lipid-binding protein YSP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YSP2 PE=1 SV=1
15	PDB:2h8hA	0.077	0.121	4.557E-3	445	0.034	0.054	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
16	PDB:7pgrN	0.122	0.040	4.819E-3	2423	0.024	0.007	7pgrN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.
17	PDB:6x5hA	0.088	0.130	5.095E-3	467	0.030	0.045	6x5hA.pdb.gz	Characterizing human alpha-1,6-fucosyltransferase (FUT8) substrate specificity and structural similarities with related fucosyltransferases.
18	PDB:3ehqA	0.082	0.291	6.368E-3	182	0.030	0.115	3ehqA.pdb.gz
19	AFDB:Q9QWY8	0.084	0.054	6.720E-3	1147	0.118	0.073	Q9QWY8.pdb.gz	ASAP1_MOUSE Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Mus musculus OX=10090 GN=Asap1 PE=1 SV=2
20	AFDB:P38800	0.116	0.065	7.513E-3	1345	0.141	0.074	P38800.pdb.gz	LAM4_YEAST Membrane-anchored lipid-binding protein LAM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LAM4 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PBB9	0.0	1393	701	0.952	0.966	E9PBB9_HUMAN Mitogen-activated protein kinase 8 interacting protein 1 OS=Homo sapiens OX=9606 GN=MAPK8IP1 PE=1 SV=1
2	Q9R237	0.0	1298	708	0.935	0.939	JIP1_RAT C-Jun-amino-terminal kinase-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Mapk8ip1 PE=1 SV=2
3	Q9UQF2	0.0	1461	711	1.000	1.000	JIP1_HUMAN C-Jun-amino-terminal kinase-interacting protein 1 OS=Homo sapiens OX=9606 GN=MAPK8IP1 PE=1 SV=1
4	Q9WVI9	0.0	1320	707	0.935	0.941	JIP1_MOUSE C-Jun-amino-terminal kinase-interacting protein 1 OS=Mus musculus OX=10090 GN=Mapk8ip1 PE=1 SV=2
5	Q9ERE9	3.48e-125	394	830	0.271	0.233	JIP2_MOUSE C-Jun-amino-terminal kinase-interacting protein 2 OS=Mus musculus OX=10090 GN=Mapk8ip2 PE=1 SV=1
6	G3V9M2	7.07e-125	393	835	0.276	0.235	JIP2_RAT C-Jun-amino-terminal kinase-interacting protein 2 OS=Rattus norvegicus OX=10116 GN=Mapk8ip2 PE=1 SV=1
7	Q13387	4.81e-123	388	824	0.267	0.231	JIP2_HUMAN C-Jun-amino-terminal kinase-interacting protein 2 OS=Homo sapiens OX=9606 GN=MAPK8IP2 PE=1 SV=2
8	Q9W0K0	1.79e-58	207	490	0.139	0.202	JIP1_DROME JNK-interacting protein 1 OS=Drosophila melanogaster OX=7227 GN=Aplip1 PE=1 SV=2
9	Q9UBP9	4.57e-12	69.7	304	0.062	0.145	GULP1_HUMAN PTB domain-containing engulfment adapter protein 1 OS=Homo sapiens OX=9606 GN=GULP1 PE=1 SV=1
10	F1LIN5	4.58e-07	55.5	535	0.052	0.069	F1LIN5_CAEEL PID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=num-1 PE=1 SV=1
11	Q9XTY6	5.94e-07	55.1	593	0.052	0.062	NUMB1_CAEEL Numb-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=num-1 PE=1 SV=1
12	B5BM46	8.18e-07	54.7	682	0.052	0.054	B5BM46_CAEEL PID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=num-1 PE=1 SV=1
13	O76337	8.25e-07	54.7	492	0.052	0.075	CED6_CAEEL Cell death protein 6 OS=Caenorhabditis elegans OX=6239 GN=ced-6 PE=1 SV=1
14	Q7JUY7	1.75e-06	53.5	517	0.058	0.079	CED6_DROME PTB domain-containing adapter protein ced-6 OS=Drosophila melanogaster OX=7227 GN=ced-6 PE=1 SV=1
15	Q69ZI1	2.40e-06	53.5	892	0.034	0.027	SH3R1_MOUSE E3 ubiquitin-protein ligase SH3RF1 OS=Mus musculus OX=10090 GN=Sh3rf1 PE=1 SV=2
16	Q71F54	2.97e-06	53.1	894	0.034	0.027	SH3R1_RAT E3 ubiquitin-protein ligase SH3RF1 OS=Rattus norvegicus OX=10116 GN=Sh3rf1 PE=1 SV=1
17	Q6NRD3	3.78e-06	52.8	826	0.032	0.028	SH3R1_XENLA E3 ubiquitin-protein ligase SH3RF1 OS=Xenopus laevis OX=8355 GN=sh3rf1 PE=1 SV=1
18	Q7Z6J0	6.79e-06	52.0	888	0.032	0.026	SH3R1_HUMAN E3 ubiquitin-protein ligase SH3RF1 OS=Homo sapiens OX=9606 GN=SH3RF1 PE=1 SV=2
19	A1L1I3	1.76e-05	50.4	614	0.056	0.065	NUMBL_RAT Numb-like protein OS=Rattus norvegicus OX=10116 GN=Numbl PE=1 SV=1
20	A0A286Y8T8	1.84e-05	50.4	640	0.049	0.055	A0A286Y8T8_DANRE NUMB-like endocytic adaptor protein OS=Danio rerio OX=7955 GN=z-numb PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00640 PID	2.6e-31	120.0	Phosphotyrosine interaction domain (PTB/PID)
2	PF14719 PID_2	7.1	18.0	Phosphotyrosine interaction domain (PTB/PID)
3	PF00018 SH3_1	0.0068	27.3	SH3 domain
4	PF07653 SH3_2	35	15.6	Variant SH3 domain
5	PF14604 SH3_9	6.9e-09	46.8	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000241014

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378974	0.999	Mitogen-activated protein kinase 8
2	9606.ENSP00000381070	0.999	Dual specificity mitogen-activated protein kinase kinase 7
3	9606.ENSP00000394560	0.999	Mitogen-activated protein kinase 9
4	9606.ENSP00000451828	0.994	RAC-alpha serine/threonine-protein kinase
5	9606.ENSP00000309597	0.992	Mitogen-activated protein kinase kinase kinase 11
6	9606.ENSP00000352157	0.991	Mitogen-activated protein kinase 10
7	9606.ENSP00000414982	0.990	Kinesin light chain 1
8	9606.ENSP00000303634	0.988	Low-density lipoprotein receptor-related protein 8
9	9606.ENSP00000284981	0.986	Amyloid-beta A4 protein
10	9606.ENSP00000298573	0.983	Dual specificity protein phosphatase 16
11	9606.ENSP00000250894	0.978	C-Jun-amino-terminal kinase-interacting protein 3
12	9606.ENSP00000330572	0.974	C-Jun-amino-terminal kinase-interacting protein 2
13	9606.ENSP00000448689	0.944	Mitogen-activated protein kinase kinase kinase 12
14	9606.ENSP00000439065	0.935	Uncharacterized protein
15	9606.ENSP00000262013	0.934	C-Jun-amino-terminal kinase-interacting protein 4
16	9606.ENSP00000265026	0.891	Mitogen-activated protein kinase kinase kinase 13
17	9606.ENSP00000360266	0.878	Transcription factor AP-1
18	9606.ENSP00000298910	0.871	Leucine-rich repeat serine/threonine-protein kinase 2
19	9606.ENSP00000465039	0.845	Mitogen-activated protein kinase kinase kinase kinase 1
20	9606.ENSP00000441913	0.831	Rho guanine nucleotide exchange factor 28

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019894	0.999	kinesin binding
GO:0019901	0.998	protein kinase binding
GO:0005078	0.997	MAP-kinase scaffold activity
GO:0030234	0.928	enzyme regulator activity
GO:0019207	0.913	kinase regulator activity
GO:0019887	0.902	protein kinase regulator activity
GO:0004857	0.899	enzyme inhibitor activity
GO:0019210	0.887	kinase inhibitor activity
GO:0004860	0.861	protein kinase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043408	0.997	regulation of MAPK cascade
GO:0070302	0.996	regulation of stress-activated protein kinase signaling cascade
GO:0009987	0.995	cellular process
GO:0050896	0.992	response to stimulus
GO:0051716	0.984	cellular response to stimulus
GO:0007154	0.981	cell communication
GO:0032872	0.978	regulation of stress-activated MAPK cascade
GO:0046328	0.974	regulation of JNK cascade
GO:0023052	0.970	signaling
GO:0043066	0.966	negative regulation of apoptotic process
GO:0007165	0.961	signal transduction
GO:0009968	0.940	negative regulation of signal transduction
GO:1902532	0.871	negative regulation of intracellular signal transduction
GO:0019222	0.838	regulation of metabolic process
GO:0060255	0.825	regulation of macromolecule metabolic process
GO:0080090	0.822	regulation of primary metabolic process
GO:0051171	0.820	regulation of nitrogen compound metabolic process
GO:0031323	0.804	regulation of cellular metabolic process
GO:0048518	0.768	positive regulation of biological process
GO:0035556	0.720	intracellular signal transduction
GO:0048522	0.704	positive regulation of cellular process
GO:0008152	0.566	metabolic process
GO:0044237	0.556	cellular metabolic process
GO:0071704	0.507	organic substance metabolic process
GO:0044238	0.488	primary metabolic process
GO:0006807	0.446	nitrogen compound metabolic process
GO:0065009	0.443	regulation of molecular function
GO:0006950	0.423	response to stress
GO:0043170	0.395	macromolecule metabolic process
GO:1901564	0.362	organonitrogen compound metabolic process
GO:0000165	0.347	MAPK cascade
GO:0019538	0.323	protein metabolic process
GO:0051246	0.316	regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	0.997	plasma membrane
GO:0005829	0.985	cytosol
GO:0043227	0.816	membrane-bounded organelle
GO:0043229	0.816	intracellular organelle
GO:0043231	0.812	intracellular membrane-bounded organelle
GO:0032991	0.628	protein-containing complex
GO:0120025	0.577	plasma membrane bounded cell projection
GO:0043005	0.453	neuron projection
GO:0070013	0.327	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]