StarFunc result for job id Q9UQK1

User Input

>input (317 residues)
MSCTRMIQVLDPRPLTSSVMPVDVAMRLCLAHSPPVKSFLGPYDEFQRRHFVNKLKPLKS
CLNIKHKAKSQNDWKCSHNQAKKRVVFADSKGLSLTAIHVFSDLPEEPAWDLQFDLLDLN
DISSALKHHEEKNLILDFPQPSTDYLSFRSHFQKNFVCLENCSLQERTVTGTVKVKNVSF
EKKVQIRITFDSWKNYTDVDCVYMKNVYGGTDSDTFSFAIDLPPVIPTEQKIEFCISYHA
NGQVFWDNNDGQNYRIVHVQWKPDGVQTQMAPQDCAFHQTSPKTELESTIFGSPRLASGL
FPEWQSWGRMENLASYR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UQK1	1.000	1.000	7.709E-60	317	1.000	1.000	Q9UQK1.pdb.gz	PPR3C_HUMAN Protein phosphatase 1 regulatory subunit 3C OS=Homo sapiens OX=9606 GN=PPP1R3C PE=1 SV=2
2	AFDB:Q5U2R5	0.547	0.547	2.581E-52	317	0.855	0.855	Q5U2R5.pdb.gz	PPR3C_RAT Protein phosphatase 1 regulatory subunit 3C OS=Rattus norvegicus OX=10116 GN=Ppp1r3c PE=2 SV=1
3	AFDB:Q6IN01	0.426	0.473	4.415E-29	284	0.369	0.412	Q6IN01.pdb.gz	PPR3B_RAT Protein phosphatase 1 regulatory subunit 3B OS=Rattus norvegicus OX=10116 GN=Ppp1r3b PE=1 SV=1
4	AFDB:Q86XI6	0.422	0.467	2.261E-28	285	0.356	0.396	Q86XI6.pdb.gz	PPR3B_HUMAN Protein phosphatase 1 regulatory subunit 3B OS=Homo sapiens OX=9606 GN=PPP1R3B PE=1 SV=1
5	AFDB:T1SFR8	0.420	0.467	3.309E-27	285	0.356	0.396	T1SFR8.pdb.gz	PPR3C_CLABA Protein phosphatase 1 regulatory subunit 3C OS=Clarias batrachus OX=59899 GN=PPP1R3C PE=2 SV=1
6	AFDB:F1QYL9	0.388	0.484	3.644E-22	253	0.274	0.344	F1QYL9.pdb.gz
7	AFDB:Q8SXW5	0.369	0.307	9.301E-20	384	0.259	0.214	Q8SXW5.pdb.gz	Q8SXW5_DROME Protein phosphatase 1 regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Gbs-70E PE=2 SV=1
8	AFDB:D3ZZ26	0.374	0.423	9.050E-19	279	0.233	0.265	D3ZZ26.pdb.gz	D3ZZ26_RAT Protein phosphatase 1, regulatory subunit 3D OS=Rattus norvegicus OX=10116 GN=Ppp1r3d PE=1 SV=1
9	AFDB:O95685	0.386	0.408	1.489E-17	299	0.233	0.247	O95685.pdb.gz	PPR3D_HUMAN Protein phosphatase 1 regulatory subunit 3D OS=Homo sapiens OX=9606 GN=PPP1R3D PE=1 SV=1
10	AFDB:Q99MR9	0.383	0.121	6.784E-17	1089	0.259	0.075	Q99MR9.pdb.gz	PPR3A_MOUSE Protein phosphatase 1 regulatory subunit 3A OS=Mus musculus OX=10090 GN=Ppp1r3a PE=1 SV=2
11	PDB:1j0hA	0.222	0.124	2.306E-4	588	0.025	0.014	1j0hA.pdb.gz	Three-dimensional Structure and Substrate Binding of Bacillus stearothermophilus Neopullulanase
12	PDB:7vt9A	0.232	0.127	6.217E-4	604	0.032	0.017	7vt9A.pdb.gz
13	PDB:1ea9C	0.214	0.121	1.492E-3	583	0.038	0.021	1ea9C.pdb.gz
14	PDB:1xl6A	0.152	0.161	3.793E-3	291	0.076	0.082	1xl6A.pdb.gz
15	PDB:1ogpA	0.190	0.159	5.383E-3	388	0.044	0.036	1ogpA.pdb.gz	The Crystal Structure of Plant Sulfite Oxidase Provides Insights Into Sulfite Oxidation in Plants and Animals
16	PDB:2ag2A	0.189	0.314	5.706E-3	164	0.047	0.091	2ag2A.pdb.gz	Crystal Structure Analysis of Phosphatidylcholine-GM2-Activator Product Complexes: Evidence for Hydrolase Activity.
17	PDB:1yycA	0.177	0.281	6.049E-3	174	0.050	0.092	1yycA.pdb.gz
18	PDB:2agcA	0.168	0.275	6.798E-3	162	0.050	0.099	2agcA.pdb.gz
19	PDB:5cltA	0.181	0.102	1.631E-2	646	0.066	0.033	5cltA.pdb.gz	Crystal structure of human glycogen branching enzyme (GBE1) in complex with acarbose
20	PDB:5ewiL	0.211	0.290	1.833E-2	217	0.032	0.046	5ewiL.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5U2R5	0.0	580	317	0.855	0.855	PPR3C_RAT Protein phosphatase 1 regulatory subunit 3C OS=Rattus norvegicus OX=10116 GN=Ppp1r3c PE=2 SV=1
2	Q7TMB3	0.0	568	317	0.861	0.861	PPR3C_MOUSE Protein phosphatase 1 regulatory subunit 3C OS=Mus musculus OX=10090 GN=Ppp1r3c PE=1 SV=1
3	Q9UQK1	0.0	665	317	1.000	1.000	PPR3C_HUMAN Protein phosphatase 1 regulatory subunit 3C OS=Homo sapiens OX=9606 GN=PPP1R3C PE=1 SV=2
4	Q86XI6	4.65e-73	228	285	0.388	0.432	PPR3B_HUMAN Protein phosphatase 1 regulatory subunit 3B OS=Homo sapiens OX=9606 GN=PPP1R3B PE=1 SV=1
5	Q6IN01	2.15e-72	227	284	0.372	0.415	PPR3B_RAT Protein phosphatase 1 regulatory subunit 3B OS=Rattus norvegicus OX=10116 GN=Ppp1r3b PE=1 SV=1
6	Q8C767	2.82e-72	226	284	0.372	0.415	PPR3B_MOUSE Protein phosphatase 1 regulatory subunit 3B OS=Mus musculus OX=10090 GN=Ppp1r3b PE=1 SV=1
7	T1SFR8	1.03e-64	207	285	0.353	0.393	PPR3C_CLABA Protein phosphatase 1 regulatory subunit 3C OS=Clarias batrachus OX=59899 GN=PPP1R3C PE=2 SV=1
8	Q6NX94	2.93e-44	153	253	0.290	0.364	Q6NX94_DANRE Protein phosphatase 1 regulatory subunit OS=Danio rerio OX=7955 GN=fj66e08 PE=2 SV=1
9	Q8SWT8	4.96e-40	144	330	0.249	0.239	Q8SWT8_DROME Protein phosphatase 1 regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Gbs-70E PE=2 SV=1
10	Q9VUF3	1.21e-39	145	384	0.249	0.206	Q9VUF3_DROME Protein phosphatase 1 regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Gbs-70E PE=4 SV=1
11	Q8SXW5	1.36e-38	142	384	0.246	0.203	Q8SXW5_DROME Protein phosphatase 1 regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Gbs-70E PE=2 SV=1
12	D3ZZ26	1.00e-23	100	279	0.189	0.215	D3ZZ26_RAT Protein phosphatase 1, regulatory subunit 3D OS=Rattus norvegicus OX=10116 GN=Ppp1r3d PE=1 SV=1
13	O95685	2.05e-23	99.8	299	0.215	0.227	PPR3D_HUMAN Protein phosphatase 1 regulatory subunit 3D OS=Homo sapiens OX=9606 GN=PPP1R3D PE=1 SV=1
14	Q99MR9	1.44e-20	94.7	1089	0.205	0.060	PPR3A_MOUSE Protein phosphatase 1 regulatory subunit 3A OS=Mus musculus OX=10090 GN=Ppp1r3a PE=1 SV=2
15	Q9VVY3	7.65e-18	86.3	681	0.192	0.090	GBS76_DROME Glycogen-binding subunit 76A OS=Drosophila melanogaster OX=7227 GN=Gbs-76A PE=1 SV=1
16	Q00756	4.87e-17	84.0	1109	0.189	0.054	PPR3A_RABIT Protein phosphatase 1 regulatory subunit 3A OS=Oryctolagus cuniculus OX=9986 GN=PPP1R3A PE=1 SV=1
17	P0C7L8	1.51e-15	77.4	279	0.155	0.176	PPR3E_RAT Protein phosphatase 1 regulatory subunit 3E OS=Rattus norvegicus OX=10116 GN=Ppp1r3e PE=2 SV=1
18	P40036	7.81e-15	77.0	548	0.117	0.068	GIP2_YEAST GLC7-interacting protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GIP2 PE=1 SV=1
19	Q9CW07	1.62e-12	69.3	347	0.205	0.187	PP13G_MOUSE Protein phosphatase 1 regulatory subunit 3G OS=Mus musculus OX=10090 GN=Ppp1r3g PE=1 SV=2
20	P40187	1.95e-12	69.7	538	0.120	0.071	PIG2_YEAST GSY2-interacting protein PIG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PIG2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16760 CBM53	3e-13	61.5	Starch/carbohydrate-binding module (family 53)
2	PF03370 CBM_21	2.7e-29	113.0	Carbohydrate/starch-binding module (family 21)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000238994

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356489	0.990	Laforin
2	9606.ENSP00000317904	0.989	Glycogen [starch] synthase, muscle
3	9606.ENSP00000341779	0.986	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
4	9606.ENSP00000345464	0.983	E3 ubiquitin-protein ligase NHLRC1
5	9606.ENSP00000261195	0.980	Glycogen [starch] synthase, liver
6	9606.ENSP00000326031	0.978	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
7	9606.ENSP00000340736	0.977	Glycogenin-1
8	9606.ENSP00000378769	0.975	Serine/threonine-protein phosphatase PP1-beta catalytic subunit
9	9606.ENSP00000360035	0.973	Protein phosphatase 1 regulatory subunit 3D
10	9606.ENSP00000237642	0.912	Starch-binding domain-containing protein 1
11	9606.ENSP00000304697	0.904	Polyubiquitin-B
12	9606.ENSP00000441543	0.904	Polyubiquitin-C
13	9606.ENSP00000388107	0.902	Ubiquitin-60S ribosomal protein L40
14	9606.ENSP00000272317	0.900	Ubiquitin-40S ribosomal protein S27a
15	9606.ENSP00000370555	0.873	Glycogenin-2
16	9606.ENSP00000284601	0.848	Protein phosphatase 1 regulatory subunit 3A
17	9606.ENSP00000408288	0.839	Protein phosphatase 1 regulatory subunit 3E
18	9606.ENSP00000055335	0.831	Protein phosphatase 1 regulatory subunit 3F
19	9606.ENSP00000311677	0.824	Nuclear inhibitor of protein phosphatase 1
20	9606.ENSP00000308318	0.818	Protein phosphatase 1 regulatory subunit 3B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004721	1.000	phosphoprotein phosphatase activity
GO:0019899	0.989	enzyme binding
GO:0004722	0.891	protein serine/threonine phosphatase activity
GO:0098772	0.449	molecular function regulator activity
GO:0030234	0.390	enzyme regulator activity
GO:0019903	0.355	protein phosphatase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.982	organic substance metabolic process
GO:0044238	0.981	primary metabolic process
GO:0044237	0.981	cellular metabolic process
GO:0050794	0.976	regulation of cellular process
GO:0043170	0.967	macromolecule metabolic process
GO:0080090	0.948	regulation of primary metabolic process
GO:0031323	0.947	regulation of cellular metabolic process
GO:0060255	0.940	regulation of macromolecule metabolic process
GO:0006112	0.915	energy reserve metabolic process
GO:0044042	0.915	glucan metabolic process
GO:0044264	0.915	cellular polysaccharide metabolic process
GO:0006073	0.903	cellular glucan metabolic process
GO:0005977	0.809	glycogen metabolic process
GO:0006109	0.791	regulation of carbohydrate metabolic process
GO:0043467	0.784	regulation of generation of precursor metabolites and energy
GO:0032881	0.754	regulation of polysaccharide metabolic process
GO:0010675	0.724	regulation of cellular carbohydrate metabolic process
GO:0016051	0.676	carbohydrate biosynthetic process
GO:0033692	0.649	cellular polysaccharide biosynthetic process
GO:0051179	0.644	localization
GO:0006810	0.617	transport
GO:0043470	0.552	regulation of carbohydrate catabolic process
GO:0010962	0.536	regulation of glucan biosynthetic process
GO:0051641	0.491	cellular localization
GO:0009250	0.416	glucan biosynthetic process
GO:0070873	0.377	regulation of glycogen metabolic process
GO:0033036	0.374	macromolecule localization
GO:0046907	0.352	intracellular transport
GO:0005978	0.319	glycogen biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043227	0.853	membrane-bounded organelle
GO:0043229	0.834	intracellular organelle
GO:0043231	0.784	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.
EC:3.1.3.16	0.891	protein-serine/threonine phosphatase.

[back to server]