StarFunc result for job id Q9UQL6

User Input

>input (1122 residues)
MNSPNESDGMSGREPSLEILPRTSLHSIPVTVEVKPVLPRAMPSSMGGGGGGSPSPVELR
GALVGSVDPTLREQQLQQELLALKQQQQLQKQLLFAEFQKQHDHLTRQHEVQLQKHLKQQ
QEMLAAKQQQEMLAAKRQQELEQQRQREQQRQEELEKQRLEQQLLILRNKEKSKESAIAS
TEVKLRLQEFLLSKSKEPTPGGLNHSLPQHPKCWGAHHASLDQSSPPQSGPPGTPPSYKL
PLPGPYDSRDDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGTVISTFKKRAVEI
TGAGPGASSVCNSAPGSGPSSPNSSHSTIAENGFTGSVPNIPTEMLPQHRALPLDSSPNQ
FSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMST
SSIPGCLLGVALEGDGSPHGHASLLQHVLLLEQARQQSTLIAVPLHGQSPLVTGERVATS
MRTVGKLPRHRPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQKQQQLQLGKILTKTGE
LPRQPTTHPEETEEELTEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEED
CIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQPLQPLQVYQAPLSLATVPHQALGRTQ
SSPAAPGGMKSPPDQPVKHLFTTGVVYDTFMLKHQCMCGNTHVHPEHAGRIQSIWSRLQE
TGLLSKCERIRGRKATLDEIQTVHSEYHTLLYGTSPLNRQKLDSKKLLGPISQKMYAVLP
CGGIGVDSDTVWNEMHSSSAVRMAVGCLLELAFKVAAGELKNGFAIIRPPGHHAEESTAM
GFCFFNSVAITAKLLQQKLNVGKVLIVDWDIHHGNGTQQAFYNDPSVLYISLHRYDNGNF
FPGSGAPEEVGGGPGVGYNVNVAWTGGVDPPIGDVEYLTAFRTVVMPIAHEFSPDVVLVS
AGFDAVEGHLSPLGGYSVTARCFGHLTRQLMTLAGGRVVLALEGGHDLTAICDASEACVS
ALLSVELQPLDEAVLQQKPNINAVATLEKVIEIQSKHWSCVQKFAAGLGRSLREAQAGET
EEAETVSAMALLSVGAEQAQAAAAREHSPRPAEEPMEQEPAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UQL6	1.000	1.000	0.000	1122	1.000	1.000	Q9UQL6.pdb.gz	HDAC5_HUMAN Histone deacetylase 5 OS=Homo sapiens OX=9606 GN=HDAC5 PE=1 SV=2
2	AFDB:P56524	0.425	0.438	8.377E-98	1084	0.586	0.606	P56524.pdb.gz	HDAC4_HUMAN Histone deacetylase 4 OS=Homo sapiens OX=9606 GN=HDAC4 PE=1 SV=3
3	AFDB:A0A0R4IAH0	0.437	0.464	3.586E-92	1052	0.539	0.575	A0A0R4IAH0.pdb.gz	A0A0R4IAH0_DANRE Histone deacetylase OS=Danio rerio OX=7955 GN=wu:fa96d08 PE=1 SV=1
4	AFDB:J3KPH8	0.350	0.385	1.084E-68	1014	0.377	0.417	J3KPH8.pdb.gz	J3KPH8_HUMAN Histone deacetylase OS=Homo sapiens OX=9606 GN=HDAC7 PE=1 SV=1
5	AFDB:Q59E49	0.368	0.344	4.522E-68	1203	0.350	0.327	Q59E49.pdb.gz	Q59E49_DROME Histone deacetylase OS=Drosophila melanogaster OX=7227 GN=HDAC4 PE=1 SV=2
6	PDB:5eduB	0.293	0.450	2.190E-36	723	0.140	0.217	5eduB.pdb.gz	Histone deacetylase 6 structure and molecular basis of catalysis and inhibition.
7	PDB:6z6fB	0.298	0.498	5.631E-34	661	0.130	0.221	6z6fB.pdb.gz	Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.
8	PDB:7sggA	0.298	0.512	4.070E-33	644	0.109	0.189	7sggA.pdb.gz	Aza-SAHA Derivatives Are Selective Histone Deacetylase 10 Chemical Probes That Inhibit Polyamine Deacetylation and Phenocopy HDAC10 Knockout.
9	PDB:5ikkA	0.273	0.506	7.869E-33	594	0.128	0.242	5ikkA.pdb.gz	SHREC Silences Heterochromatin via Distinct Remodeling and Deacetylation Modules.
10	PDB:6uijA	0.294	0.524	5.096E-32	620	0.110	0.198	6uijA.pdb.gz	Binding ofN8-Acetylspermidine Analogues to Histone Deacetylase 10 Reveals Molecular Strategies for Blocking Polyamine Deacetylation.
11	PDB:5g0yB	0.276	0.772	1.186E-27	377	0.094	0.281	5g0yB.pdb.gz	Crystal Structure of a Histone Deacetylase Homologue from Pseudomonas aeruginosa.
12	PDB:7zzuB	0.271	0.772	2.118E-21	371	0.078	0.237	7zzuB.pdb.gz	Fragment-Based Discovery of a Novel, Brain Penetrant, Orally Active HDAC2 Inhibitor.
13	PDB:4qa0A	0.264	0.744	1.531E-20	371	0.074	0.224	4qa0A.pdb.gz	Compromised Structure and Function of HDAC8 Mutants Identified in Cornelia de Lange Syndrome Spectrum Disorders.
14	PDB:3sfhA	0.253	0.779	7.533E-20	342	0.070	0.231	3sfhA.pdb.gz	Human HDAC isoform selectivity achieved via exploitation of the acetate release channel with structurally unique small molecule inhibitors.
15	PDB:5zeeB	0.136	0.425	1.013E-4	297	0.029	0.108	5zeeB.pdb.gz	Structural insights into Entamoeba histolytica arginase and structure-based identification of novel non-amino acid based inhibitors as potential antiamoebic molecules.
16	AFDB:Q54WH7	0.091	0.128	3.839E-3	759	0.086	0.128	Q54WH7.pdb.gz	Y5961_DICDI Putative uncharacterized protein DDB_G0279653 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279653 PE=4 SV=1
17	AFDB:E9AFM3	0.031	0.044	1.996E-2	796	0.103	0.146	E9AFM3.pdb.gz	E9AFM3_LEIMA 4E-interacting protein OS=Leishmania major OX=5664 GN=LMJF_35_3980 PE=1 SV=1
18	AFDB:Q5YL88	0.053	0.053	3.652E-2	1205	0.124	0.115	Q5YL88.pdb.gz	Q5YL88_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific (Fragment) OS=Mus musculus OX=10090 GN=Dot1l PE=2 SV=1
19	AFDB:Q3BBV0	0.064	0.060	5.365E-2	1214	0.096	0.089	Q3BBV0.pdb.gz	NBPF1_HUMAN Neuroblastoma breakpoint family member 1 OS=Homo sapiens OX=9606 GN=NBPF1 PE=1 SV=2
20	AFDB:Q9UNY4	0.107	0.105	1.037E-1	1162	0.104	0.101	Q9UNY4.pdb.gz	TTF2_HUMAN Transcription termination factor 2 OS=Homo sapiens OX=9606 GN=TTF2 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K082	1009	1043	0.544	0.585	A0A0G2K082_RAT Histone deacetylase OS=Rattus norvegicus OX=10116 GN=Hdac9 PE=3 SV=2
2	A0A0R4IAH0	1055	1052	0.561	0.598	A0A0R4IAH0_DANRE Histone deacetylase OS=Danio rerio OX=7955 GN=wu:fa96d08 PE=1 SV=1
3	A0A8I5XW09	1785	1089	0.930	0.958	A0A8I5XW09_RAT Histone deacetylase OS=Rattus norvegicus OX=10116 GN=Hdac5 PE=3 SV=1
4	A0A8I5ZWP6	825	1024	0.412	0.451	A0A8I5ZWP6_RAT Histone deacetylase OS=Rattus norvegicus OX=10116 GN=Hdac9 PE=3 SV=1
5	A0A8I6AAJ0	675	1029	0.304	0.331	A0A8I6AAJ0_RAT Histone deacetylase OS=Rattus norvegicus OX=10116 GN=Hdac5 PE=3 SV=1
6	A0A8I6G4R8	1839	1114	0.949	0.956	A0A8I6G4R8_RAT Histone deacetylase OS=Rattus norvegicus OX=10116 GN=Hdac5 PE=3 SV=1
7	E5RQ38	1047	1068	0.564	0.593	E5RQ38_RAT Histone deacetylase OS=Rattus norvegicus OX=10116 GN=Hdac9 PE=2 SV=1
8	E5RQ39	759	934	0.372	0.446	E5RQ39_RAT histone deacetylase (Fragment) OS=Rattus norvegicus OX=10116 GN=Hdac9 PE=2 SV=1
9	E7FH14	1397	1128	0.709	0.705	E7FH14_DANRE Histone deacetylase OS=Danio rerio OX=7955 GN=hdac5 PE=3 SV=2
10	F1LM64	1632	970	0.805	0.931	F1LM64_RAT Histone deacetylase OS=Rattus norvegicus OX=10116 GN=Hdac5 PE=1 SV=4
11	J3KPH8	607	1014	0.250	0.276	J3KPH8_HUMAN Histone deacetylase OS=Homo sapiens OX=9606 GN=HDAC7 PE=1 SV=1
12	P56524	1097	1084	0.585	0.605	HDAC4_HUMAN Histone deacetylase 4 OS=Homo sapiens OX=9606 GN=HDAC4 PE=1 SV=3
13	P83038	1100	1080	0.604	0.628	HDAC4_CHICK Histone deacetylase 4 OS=Gallus gallus OX=9031 GN=HDAC4 PE=2 SV=1
14	Q08BS8	1041	1023	0.551	0.604	Q08BS8_DANRE Histone deacetylase OS=Danio rerio OX=7955 GN=zgc:152701 PE=1 SV=1
15	Q5RJZ2	659	328	0.282	0.963	Q5RJZ2_RAT Hdac5 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Hdac5 PE=2 SV=1
16	Q6NZM9	1068	1076	0.578	0.603	HDAC4_MOUSE Histone deacetylase 4 OS=Mus musculus OX=10090 GN=Hdac4 PE=1 SV=1
17	Q8C2B3	637	938	0.303	0.362	HDAC7_MOUSE Histone deacetylase 7 OS=Mus musculus OX=10090 GN=Hdac7 PE=1 SV=2
18	Q8WUI4	640	952	0.264	0.311	HDAC7_HUMAN Histone deacetylase 7 OS=Homo sapiens OX=9606 GN=HDAC7 PE=1 SV=2
19	Q99P99	1061	1077	0.578	0.602	HDAC4_RAT Histone deacetylase 4 OS=Rattus norvegicus OX=10116 GN=Hdac4 PE=1 SV=2
20	Q9UKV0	1013	1011	0.541	0.600	HDAC9_HUMAN Histone deacetylase 9 OS=Homo sapiens OX=9606 GN=HDAC9 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12203 HDAC4_Gln	4.1e-24	95.9	Glutamine rich N terminal domain of histone deacetylase 4
2	PF00850 Hist_deacetyl	2.9e-81	284.8	Histone deacetylase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000225983

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000346389	0.999	Myocyte-specific enhancer factor 2A
2	9606.ENSP00000268712	0.995	Nuclear receptor corepressor 1
3	9606.ENSP00000271555	0.995	Myocyte-specific enhancer factor 2D
4	9606.ENSP00000340874	0.994	Myocyte-specific enhancer factor 2C
5	9606.ENSP00000384018	0.993	Nuclear receptor corepressor 2
6	9606.ENSP00000264335	0.988	14-3-3 protein epsilon
7	9606.ENSP00000296785	0.984	Ankyrin repeat family A protein 2
8	9606.ENSP00000384371	0.984	B-cell lymphoma 6 protein
9	9606.ENSP00000365858	0.980	Erythroid transcription factor
10	9606.ENSP00000361930	0.975	14-3-3 protein beta/alpha
11	9606.ENSP00000378402	0.966	Paired amphipathic helix protein Sin3a
12	9606.ENSP00000248975	0.964	14-3-3 protein eta
13	9606.ENSP00000345681	0.960	Endothelial transcription factor GATA-2
14	9606.ENSP00000357979	0.960	Nuclear receptor subfamily 2 group E member 1
15	9606.ENSP00000430432	0.955	Histone deacetylase 2
16	9606.ENSP00000302967	0.954	Histone deacetylase 3
17	9606.ENSP00000358716	0.954	Probable ATP-dependent RNA helicase DDX20
18	9606.ENSP00000332194	0.953	Histone H2A type 2-C
19	9606.ENSP00000305071	0.944	DNA-binding protein RFXANK
20	9606.ENSP00000369131	0.944	Paired amphipathic helix protein Sin3b

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004407	1.000	histone deacetylase activity
GO:0003682	0.999	chromatin binding
GO:0008134	0.997	transcription factor binding
GO:0019900	0.995	kinase binding
GO:0000977	0.995	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0042826	0.993	histone deacetylase binding
GO:0061629	0.993	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0019901	0.993	protein kinase binding
GO:0000978	0.992	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0042802	0.946	identical protein binding
GO:0001221	0.920	transcription coregulator binding
GO:0001222	0.911	transcription corepressor binding
GO:0005080	0.896	protein kinase C binding
GO:0140110	0.670	transcription regulator activity
GO:0003712	0.331	transcription coregulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0032501	0.984	multicellular organismal process
GO:0050794	0.982	regulation of cellular process
GO:0050896	0.976	response to stimulus
GO:0042221	0.971	response to chemical
GO:0032502	0.968	developmental process
GO:0048856	0.950	anatomical structure development
GO:0010033	0.948	response to organic substance
GO:0007275	0.927	multicellular organism development
GO:0048731	0.900	system development
GO:0019222	0.892	regulation of metabolic process
GO:0048869	0.888	cellular developmental process
GO:0060255	0.879	regulation of macromolecule metabolic process
GO:0016043	0.878	cellular component organization
GO:0019219	0.873	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.870	regulation of gene expression
GO:0048519	0.858	negative regulation of biological process
GO:0031326	0.858	regulation of cellular biosynthetic process
GO:0010556	0.857	regulation of macromolecule biosynthetic process
GO:0048523	0.854	negative regulation of cellular process
GO:0006355	0.850	regulation of DNA-templated transcription
GO:0071704	0.847	organic substance metabolic process
GO:0044238	0.845	primary metabolic process
GO:0006325	0.830	chromatin organization
GO:0048518	0.813	positive regulation of biological process
GO:0010243	0.802	response to organonitrogen compound
GO:0006807	0.782	nitrogen compound metabolic process
GO:0043170	0.767	macromolecule metabolic process
GO:0048522	0.733	positive regulation of cellular process
GO:0051716	0.712	cellular response to stimulus
GO:0010605	0.711	negative regulation of macromolecule metabolic process
GO:0006357	0.696	regulation of transcription by RNA polymerase II
GO:0043279	0.695	response to alkaloid
GO:0031324	0.683	negative regulation of cellular metabolic process
GO:0051172	0.682	negative regulation of nitrogen compound metabolic process
GO:0030154	0.670	cell differentiation
GO:0045934	0.656	negative regulation of nucleobase-containing compound metabolic process
GO:0045892	0.649	negative regulation of DNA-templated transcription
GO:1901564	0.648	organonitrogen compound metabolic process
GO:0019538	0.642	protein metabolic process
GO:0009893	0.628	positive regulation of metabolic process
GO:0043412	0.627	macromolecule modification
GO:0051173	0.617	positive regulation of nitrogen compound metabolic process
GO:0010604	0.616	positive regulation of macromolecule metabolic process
GO:0031325	0.601	positive regulation of cellular metabolic process
GO:0006950	0.586	response to stress
GO:0009891	0.573	positive regulation of biosynthetic process
GO:0014070	0.562	response to organic cyclic compound
GO:0045935	0.544	positive regulation of nucleobase-containing compound metabolic process
GO:1902074	0.540	response to salt
GO:0031328	0.527	positive regulation of cellular biosynthetic process
GO:0042220	0.517	response to cocaine
GO:0036211	0.509	protein modification process
GO:0007399	0.490	nervous system development
GO:0010557	0.470	positive regulation of macromolecule biosynthetic process
GO:0000122	0.460	negative regulation of transcription by RNA polymerase II
GO:1902680	0.459	positive regulation of RNA biosynthetic process
GO:0014823	0.457	response to activity
GO:0045893	0.446	positive regulation of DNA-templated transcription
GO:0009607	0.421	response to biotic stimulus
GO:0033993	0.392	response to lipid
GO:0044237	0.349	cellular metabolic process
GO:0051239	0.343	regulation of multicellular organismal process
GO:0065009	0.325	regulation of molecular function
GO:0050793	0.322	regulation of developmental process
GO:0045944	0.321	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005737	0.999	cytoplasm
GO:0005654	0.997	nucleoplasm
GO:0005829	0.937	cytosol
GO:1902494	0.878	catalytic complex
GO:0140513	0.803	nuclear protein-containing complex
GO:0012505	0.536	endomembrane system
GO:0005794	0.325	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:58196	1.000	H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone]
EC:3.5.1.98	1.000	histone deacetylase.

[back to server]