StarFunc result for job id Q9UQM7

User Input

>input (478 residues)
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKSDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEA
ISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIH
LMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7F2G0	0.996	0.996	1.335E-82	478	0.941	0.941	E7F2G0.pdb.gz
2	AFDB:Q13557	0.976	0.936	1.305E-78	499	0.868	0.832	Q13557.pdb.gz	KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens OX=9606 GN=CAMK2D PE=1 SV=3
3	AFDB:P15791	0.923	0.830	1.564E-74	533	0.860	0.771	P15791.pdb.gz	KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus OX=10116 GN=Camk2d PE=1 SV=1
4	AFDB:P08413	0.921	0.814	1.699E-73	542	0.851	0.751	P08413.pdb.gz	KCC2B_RAT Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Rattus norvegicus OX=10116 GN=Camk2b PE=1 SV=1
5	AFDB:Q923T9	0.910	0.825	4.458E-73	529	0.831	0.750	Q923T9.pdb.gz	KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus OX=10090 GN=Camk2g PE=1 SV=1
6	AFDB:A2BGW3	0.884	0.692	1.170E-72	618	0.847	0.655	A2BGW3.pdb.gz
7	AFDB:F1QW17	0.906	0.742	3.759E-72	587	0.828	0.675	F1QW17.pdb.gz	F1QW17_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=camk2g2 PE=1 SV=3
8	AFDB:A0A2R8QIR1	0.904	0.827	7.272E-72	523	0.793	0.725	A0A2R8QIR1.pdb.gz
9	PDB:5u6yA	0.598	0.623	9.258E-72	459	0.958	0.998	5u6yA.pdb.gz
10	AFDB:A0A2R8PWY6	0.890	0.928	3.883E-71	458	0.778	0.812	A0A2R8PWY6.pdb.gz
11	AFDB:A0A0R4IQT3	0.897	0.679	4.298E-71	637	0.828	0.622	A0A0R4IQT3.pdb.gz
12	PDB:3soaA	0.883	0.967	7.741E-65	436	0.904	0.991	3soaA.pdb.gz	A Mechanism for Tunable Autoinhibition in the Structure of a Human Ca(2+)/Calmodulin- Dependent Kinase II Holoenzyme.
13	PDB:8bfsA	0.516	0.876	4.192E-26	274	0.241	0.420	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326
14	PDB:2yaaA	0.551	0.864	6.066E-24	300	0.230	0.367	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
15	PDB:7myjC	0.491	0.504	1.819E-22	465	0.224	0.230	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
16	PDB:6b1uA	0.496	0.535	3.180E-22	442	0.245	0.265	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
17	PDB:4zhxA	0.500	0.581	5.558E-22	409	0.228	0.267	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
18	PDB:4rgjA	0.511	0.527	6.152E-22	463	0.228	0.235	4rgjA.pdb.gz
19	PDB:5ufuA	0.503	0.645	1.458E-21	369	0.213	0.276	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
20	PDB:4rerA	0.507	0.527	3.756E-20	459	0.238	0.248	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9QDQ2	0.0	846	531	0.854	0.768	E9QDQ2_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=CAMK2Gb PE=1 SV=2
2	F1QW17	0.0	603	587	0.609	0.496	F1QW17_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=camk2g2 PE=1 SV=3
3	G5EDZ5	0.0	672	681	0.701	0.492	G5EDZ5_CAEEL calcium/calmodulin-dependent protein kinase OS=Caenorhabditis elegans OX=6239 GN=unc-43 PE=1 SV=1
4	P08413	0.0	847	542	0.854	0.753	KCC2B_RAT Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Rattus norvegicus OX=10116 GN=Camk2b PE=1 SV=1
5	P11275	0.0	999	478	0.998	0.998	KCC2A_RAT Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Rattus norvegicus OX=10116 GN=Camk2a PE=1 SV=1
6	P11730	0.0	835	527	0.837	0.759	KCC2G_RAT Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Rattus norvegicus OX=10116 GN=Camk2g PE=1 SV=1
7	P11798	0.0	999	478	0.998	0.998	KCC2A_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus OX=10090 GN=Camk2a PE=1 SV=2
8	P15791	0.0	865	533	0.860	0.771	KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus OX=10116 GN=Camk2d PE=1 SV=1
9	P28652	0.0	850	542	0.856	0.755	KCC2B_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Mus musculus OX=10090 GN=Camk2b PE=1 SV=2
10	Q00168	0.0	771	530	0.772	0.696	KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain OS=Drosophila melanogaster OX=7227 GN=CaMKII PE=1 SV=1
11	Q13554	0.0	617	666	0.642	0.461	KCC2B_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Homo sapiens OX=9606 GN=CAMK2B PE=1 SV=3
12	Q13555	0.0	823	558	0.837	0.717	KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens OX=9606 GN=CAMK2G PE=1 SV=4
13	Q13557	0.0	884	499	0.868	0.832	KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens OX=9606 GN=CAMK2D PE=1 SV=3
14	Q32PV2	0.0	948	478	0.939	0.939	Q32PV2_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=zgc:123320 PE=1 SV=1
15	Q4V9P8	0.0	806	560	0.828	0.707	Q4V9P8_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=camk2ga PE=1 SV=1
16	Q6PHZ2	0.0	884	499	0.868	0.832	KCC2D_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus OX=10090 GN=Camk2d PE=1 SV=1
17	Q923T9	0.0	841	529	0.839	0.758	KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus OX=10090 GN=Camk2g PE=1 SV=1
18	Q9UQM7	0.0	1001	478	1.000	1.000	KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Homo sapiens OX=9606 GN=CAMK2A PE=1 SV=2
19	O62305	1.04e-179	522	720	0.542	0.360	KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans OX=6239 GN=unc-43 PE=1 SV=2
20	A5D7B9	9.88e-86	284	908	0.295	0.155	A5D7B9_BOVIN CASK protein OS=Bos taurus OX=9913 GN=CASK PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	3.1	19.2	Phosphotransferase enzyme family
2	PF08332 CaMKII_AD	1.2e-61	217.9	Calcium/calmodulin dependent protein kinase II association domain
3	PF14534 DUF4440	1.4e-05	36.8	Domain of unknown function (DUF4440)
4	PF13095 FTA2	1.1e+02	13.8	Kinetochore Sim4 complex subunit FTA2
5	PF06293 Kdo	22	15.9	Lipopolysaccharide kinase (Kdo/WaaP) family
6	PF00069 Pkinase	6.5e-72	253.6	Protein kinase domain
7	PF17667 Pkinase_fungal	26	15.1	Fungal protein kinase
8	PF07714 PK_Tyr_Ser-Thr	4.2e-29	113.2	Protein tyrosine and serine/threonine kinase
9	PF12680 SnoaL_2	47	16.1	SnoaL-like domain
10	PF13474 SnoaL_3	2.8e-05	35.8	SnoaL-like domain
11	PF13577 SnoaL_4	3.1e+02	12.8	SnoaL-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008847608.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008842719.1	0.998	Calcium/calmodulin dependent protein kinase II delta
2	1026970.XP_008835635.1	0.994	Glutamate ionotropic receptor NMDA type subunit 2B
3	1026970.XP_008834771.1	0.988	Calcium/calmodulin-dependent protein kinase type II subunit gamma isoform X1
4	1026970.XP_008832301.1	0.981	Calcium/calmodulin dependent protein kinase II beta
5	1026970.XP_008825113.1	0.974	RAB28, member RAS oncogene family
6	1026970.XP_008840549.1	0.971	Glutamate ionotropic receptor AMPA type subunit 1
7	1026970.XP_008829443.1	0.936	Glutamate receptor ionotropic, NMDA 1 isoform X1
8	1026970.XP_008847808.1	0.933	Phospholipase C gamma 1
9	1026970.XP_008819969.1	0.929	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 103 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 8 samples with support for all annotated introns
10	1026970.XP_008833832.1	0.923	Signal transducer and activator of transcription 1-alpha/beta isoform X1
11	1026970.XP_008844412.1	0.900	cAMP responsive element binding protein 1
12	1026970.XP_008828164.1	0.897	Glutamate ionotropic receptor NMDA type subunit 2A
13	1026970.XP_008832574.1	0.894	Phospholipase C beta 1
14	1026970.XP_008854240.1	0.888	Calcium/calmodulin dependent protein kinase IV
15	1026970.XP_008840540.1	0.880	Phospholipase C beta 2
16	1026970.XP_008821210.1	0.873	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 2 bases in 1 codon
17	1026970.XP_008849701.1	0.873	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
18	1026970.XP_008845434.1	0.872	Nitric oxide synthase 3
19	1026970.XP_008845671.1	0.871	Nitric oxide synthase 1
20	1026970.XP_008821105.1	0.868	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004683	1.000	calmodulin-dependent protein kinase activity
GO:0005515	0.996	protein binding
GO:0042802	0.490	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0065007	0.973	biological regulation
GO:0046777	0.965	protein autophosphorylation
GO:0050789	0.963	regulation of biological process
GO:0050794	0.946	regulation of cellular process
GO:0032501	0.894	multicellular organismal process
GO:0050896	0.802	response to stimulus
GO:0032502	0.688	developmental process
GO:0048856	0.630	anatomical structure development
GO:0007275	0.554	multicellular organism development
GO:0048731	0.466	system development
GO:0065008	0.431	regulation of biological quality
GO:0010646	0.425	regulation of cell communication
GO:0051716	0.398	cellular response to stimulus
GO:0007154	0.378	cell communication
GO:0023051	0.377	regulation of signaling
GO:0023052	0.374	signaling
GO:0051179	0.358	localization
GO:0007165	0.311	signal transduction
GO:0048513	0.305	animal organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0016020	0.997	membrane
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0005886	0.993	plasma membrane
GO:0098794	0.991	postsynapse
GO:0005634	0.989	nucleus
GO:0005829	0.980	cytosol
GO:0043005	0.971	neuron projection
GO:0098984	0.958	neuron to neuron synapse
GO:0036477	0.955	somatodendritic compartment
GO:0032991	0.942	protein-containing complex
GO:0099572	0.941	postsynaptic specialization
GO:0032279	0.935	asymmetric synapse
GO:0014069	0.934	postsynaptic density
GO:0030425	0.823	dendrite
GO:0031974	0.791	membrane-enclosed lumen
GO:0098978	0.791	glutamatergic synapse
GO:0005654	0.759	nucleoplasm
GO:0043228	0.684	non-membrane-bounded organelle
GO:0043232	0.667	intracellular non-membrane-bounded organelle
GO:0031090	0.655	organelle membrane
GO:0098588	0.563	bounding membrane of organelle
GO:0098590	0.488	plasma membrane region
GO:0044297	0.466	cell body
GO:0043025	0.455	neuronal cell body
GO:0030424	0.449	axon
GO:0012506	0.436	vesicle membrane
GO:0097708	0.425	intracellular vesicle
GO:0030659	0.414	cytoplasmic vesicle membrane
GO:1902494	0.356	catalytic complex
GO:0140535	0.354	intracellular protein-containing complex
GO:0030139	0.350	endocytic vesicle
GO:0005739	0.314	mitochondrion
GO:0030666	0.311	endocytic vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.11.17	1.000	calcium/calmodulin-dependent protein kinase.

[back to server]