StarFunc result for job id Q9UQP3

User Input

>input (1299 residues)
MSLQEMFRFPMGLLLGSVLLVASAPATLEPPGCSNKEQQVTVSHTYKIDVPKSALVQVDA
DPQPLSDDGASLLALGEAREEQNIIFRHNIRLQTPQKDCELAGSVQDLLARVKKLEEEMV
EMKEQCSAQRCCQGVTDLSRHCSGHGTFSLETCSCHCEEGREGPACERLACPGACSGHGR
CVDGRCLCHEPYVGADCGYPACPENCSGHGECVRGVCQCHEDFMSEDCSEKRCPGDCSGH
GFCDTGECYCEEGFTGLDCAQVVTPQGLQLLKNTEDSLLVSWEPSSQVDHYLLSYYPLGK
ELSGKQIQVPKEQHSYEILGLLPGTKYIVTLRNVKNEVSSSPQHLLATTDLAVLGTAWVT
DETENSLDVEWENPSTEVDYYKLRYGPMTGQEVAEVTVPKSSDPKSRYDITGLHPGTEYK
ITVVPMRGELEGKPILLNGRTEIDSPTNVVTDRVTEDTATVSWDPVQAVIDKYVVRYTSA
DGDTKEMAVHKDESSTVLTGLKPGEAYKVYVWAERGNQGSKKADTNALTEIDSPANLVTD
RVTENTATISWDPVQATIDKYVVRYTSADDQETREVLVGKEQSSTVLTGLRPGVEYTVHV
WAQKGDRESKKADTNAPTDIDSPKNLVTDRVTENMATVSWDPVQAAIDKYVVRYTSAGGE
TREVPVGKEQSSTVLTGLRPGMEYMVHVWAQKGDQESKKADTKAQTDIDSPQNLVTDRVT
ENMATVSWDPVRATIDRYVVRYTSAKDGETREVPVGKEQSSTVLTGLRPGVEYTVHVWAQ
KGAQESKKADTKAQTDIDSPQNLVTDWVTENTATVSWDPVQATIDRYVVHYTSANGETRE
VPVGKEQSSTVLTGLRPGMEYTVHVWAQKGNQESKKADTKAQTEIDGPKNLVTDWVTENM
ATVSWDPVQATIDKYMVRYTSADGETREVPVGKEHSSTVLTGLRPGMEYMVHVWAQKGAQ
ESKKADTKAQTELDPPRNLRPSAVTQSGGILTWTPPSAQIHGYILTYQFPDGTVKEMQLG
REDQRFALQGLEQGATYPVSLVAFKGGRRSRNVSTTLSTVGARFPHPSDCSQVQQNSNAA
SGLYTIYLHGDASRPLQVYCDMETDGGGWIVFQRRNTGQLDFFKRWRSYVEGFGDPMKEF
WLGLDKLHNLTTGTPARYEVRVDLQTANESAYAIYDFFQVASSKERYKLTVGKYRGTAGD
ALTYHNGWKFTTFDRDNDIALSNCALTHHGGWWYKNCHLANPNGRYGETKHSEGVNWEPW
KGHEFSIPYVELKIRPHGYSREPVLGRKKRTLRGRLRTF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2CF37	0.248	0.241	0.000	1350	0.351	0.338	A2CF37.pdb.gz
2	AFDB:Q80Z71	0.402	0.339	0.000	1560	0.810	0.674	Q80Z71.pdb.gz	TENN_MOUSE Tenascin-N OS=Mus musculus OX=10090 GN=Tnn PE=1 SV=2
3	AFDB:Q8BYI9	0.227	0.218	0.000	1358	0.363	0.347	Q8BYI9.pdb.gz	TENR_MOUSE Tenascin-R OS=Mus musculus OX=10090 GN=Tnr PE=1 SV=2
4	AFDB:Q9UQP3	1.000	1.000	0.000	1299	1.000	1.000	Q9UQP3.pdb.gz	TENN_HUMAN Tenascin-N OS=Homo sapiens OX=9606 GN=TNN PE=1 SV=2
5	AFDB:F1QYE2	0.301	0.229	1.173E-100	1811	0.310	0.223	F1QYE2.pdb.gz	F1QYE2_DANRE Tenascin C OS=Danio rerio OX=7955 GN=tenc PE=1 SV=1
6	AFDB:A0A0G2K1L0	0.303	0.205	8.203E-100	2019	0.335	0.215	A0A0G2K1L0.pdb.gz	A0A0G2K1L0_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=2
7	AFDB:Q29116	0.204	0.161	1.221E-99	1746	0.326	0.242	Q29116.pdb.gz	TENA_PIG Tenascin OS=Sus scrofa OX=9823 GN=TNC PE=1 SV=1
8	AFDB:P24821	0.274	0.184	6.800E-97	2201	0.318	0.188	P24821.pdb.gz	TENA_HUMAN Tenascin OS=Homo sapiens OX=9606 GN=TNC PE=1 SV=3
9	AFDB:Q62308	0.185	0.271	1.632E-69	860	0.202	0.306	Q62308.pdb.gz	Q62308_MOUSE Tenascin-X (Fragment) OS=Mus musculus OX=10090 GN=Tnxb PE=2 SV=1
10	AFDB:B0S602	0.168	0.103	5.912E-58	2480	0.192	0.101	B0S602.pdb.gz	B0S602_DANRE Fibronectin OS=Danio rerio OX=7955 GN=Fn PE=1 SV=1
11	PDB:1jc9A	0.158	0.908	3.252E-19	220	0.071	0.418	1jc9A.pdb.gz	The 2.0-A crystal structure of tachylectin 5A provides evidence for the common origin of the innate immunity and the blood coagulation systems.
12	PDB:3ghgB	0.154	0.485	4.013E-16	401	0.070	0.227	3ghgB.pdb.gz	Crystal structure of human fibrinogen.
13	PDB:1m1jB	0.156	0.493	6.527E-16	402	0.067	0.216	1m1jB.pdb.gz	Crystal Structure of Native Chicken Fibrinogen at 2.7 A Resolution
14	PDB:3ghgI	0.156	0.502	2.060E-15	394	0.065	0.213	3ghgI.pdb.gz	Crystal structure of human fibrinogen.
15	PDB:1ei3C	0.155	0.495	2.686E-15	397	0.062	0.204	1ei3C.pdb.gz
16	PDB:7q5zA	0.092	0.090	1.720E-14	1344	0.065	0.063	7q5zA.pdb.gz
17	PDB:5a42A	0.087	0.076	3.985E-14	1597	0.087	0.071	5a42A.pdb.gz
18	PDB:7q1yA	0.130	0.124	9.230E-14	1374	0.059	0.055	7q1yA.pdb.gz
19	PDB:7vonA	0.095	0.089	2.658E-12	1399	0.072	0.066	7vonA.pdb.gz
20	PDB:5oj2B	0.114	0.188	3.465E-12	692	0.062	0.117	5oj2B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AIS3	0.0	738	1564	0.334	0.277	A0A8I6AIS3_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=1
2	A1L306	0.0	816	1257	0.358	0.370	A1L306_HUMAN TNR protein OS=Homo sapiens OX=9606 GN=TNR PE=1 SV=1
3	E9QHI1	0.0	719	1720	0.324	0.245	E9QHI1_DANRE Tenascin C OS=Danio rerio OX=7955 GN=tenc PE=1 SV=1
4	F1QYE2	0.0	598	1811	0.274	0.197	F1QYE2_DANRE Tenascin C OS=Danio rerio OX=7955 GN=tenc PE=1 SV=1
5	H1A489	0.0	837	1356	0.360	0.345	H1A489_TAEGU Tenascin R OS=Taeniopygia guttata OX=59729 GN=TNR PE=3 SV=2
6	Q05546	0.0	827	1356	0.364	0.349	TENR_RAT Tenascin-R OS=Rattus norvegicus OX=10116 GN=Tnr PE=1 SV=1
7	Q29116	0.0	625	1746	0.276	0.205	TENA_PIG Tenascin OS=Sus scrofa OX=9823 GN=TNC PE=1 SV=1
8	Q7T3T6	0.0	796	1350	0.349	0.336	Q7T3T6_DANRE Tenascin-R OS=Danio rerio OX=7955 GN=tnr PE=1 SV=1
9	Q80Z71	0.0	1480	1560	0.568	0.473	TENN_MOUSE Tenascin-N OS=Mus musculus OX=10090 GN=Tnn PE=1 SV=2
10	Q8BYI9	0.0	835	1358	0.366	0.350	TENR_MOUSE Tenascin-R OS=Mus musculus OX=10090 GN=Tnr PE=1 SV=2
11	Q92752	0.0	831	1358	0.369	0.353	TENR_HUMAN Tenascin-R OS=Homo sapiens OX=9606 GN=TNR PE=1 SV=3
12	Q9UQP3	0.0	2702	1299	1.000	1.000	TENN_HUMAN Tenascin-N OS=Homo sapiens OX=9606 GN=TNN PE=1 SV=2
13	A0A8I6GHT4	1.59e-172	563	1928	0.265	0.178	A0A8I6GHT4_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=1
14	P24821	7.98e-164	542	2201	0.255	0.150	TENA_HUMAN Tenascin OS=Homo sapiens OX=9606 GN=TNC PE=1 SV=3
15	A0A8I6ARC1	5.49e-163	540	2202	0.262	0.154	A0A8I6ARC1_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=1
16	B2LYI9	7.67e-163	537	2019	0.263	0.169	B2LYI9_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=2 SV=1
17	A0A8I6AG89	1.21e-162	537	2019	0.263	0.169	A0A8I6AG89_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=1
18	A0A0G2K1L0	5.16e-155	516	2110	0.259	0.159	A0A0G2K1L0_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=2
19	Q80YX1	2.10e-154	514	2110	0.254	0.156	TENA_MOUSE Tenascin OS=Mus musculus OX=10090 GN=Tnc PE=1 SV=1
20	A5A8W4	6.58e-140	476	4137	0.251	0.079	A5A8W4_PIG Tenascin XB OS=Sus scrofa OX=9823 GN=TNXB PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09407 AbiEi_1	1.5	20.5	AbiEi antitoxin C-terminal domain
2	PF10828 DUF2570	1.8e+02	13.4	Protein of unknown function (DUF2570)
3	PF16389 DUF4998	4.4e-17	73.9	Domain of unknown function
4	PF04578 DUF594	5.2e+02	11.7	Protein of unknown function, DUF594
5	PF07974 EGF_2	4.5e-06	38.2	EGF-like domain
6	PF18720 EGF_Tenascin	0.0035	28.6	Tenascin EGF domain
7	PF00147 Fibrinogen_C	4.4e-72	254.0	Fibrinogen beta and gamma chains, C-terminal globular domain
8	PF00041 fn3	1e-120	405.7	Fibronectin type III domain
9	PF09294 Interfer-bind	1.3e-12	59.3	Interferon-alpha/beta receptor, fibronectin type III
10	PF10448 POC3_POC4	3.1	19.3	20S proteasome chaperone assembly proteins 3 and 4
11	PF16656 Pur_ac_phosph_N	1.3e-10	53.1	Purple acid Phosphatase, N-terminal domain
12	PF15670 Spem1	0.19	22.8	Spermatid maturation protein 1
13	PF07353 Uroplakin_II	11	16.9	Uroplakin II

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000239462

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387356	0.918	Aggrecan core protein
2	9606.ENSP00000264741	0.848	Integrin alpha-9
3	9606.ENSP00000261023	0.835	Integrin alpha-V
4	9606.ENSP00000367316	0.835	Integrin alpha-8
5	9606.ENSP00000283249	0.817	Integrin beta-6
6	9606.ENSP00000361818	0.815	Syndecan-4
7	9606.ENSP00000379350	0.810	Integrin beta-1
8	9606.ENSP00000452786	0.810	Integrin beta-3
9	9606.ENSP00000370542	0.801	Syndecan-1
10	9606.ENSP00000252575	0.736	Neurocan core protein
11	9606.ENSP00000358310	0.707	Integrin alpha-10
12	9606.ENSP00000265077	0.684	Versican core protein
13	9606.ENSP00000282588	0.679	Integrin alpha-1
14	9606.ENSP00000452120	0.678	Integrin alpha-7
15	9606.ENSP00000007722	0.670	Integrin alpha-3
16	9606.ENSP00000262407	0.670	Integrin alpha-IIb
17	9606.ENSP00000293379	0.670	Integrin alpha-5
18	9606.ENSP00000296585	0.670	Integrin alpha-2
19	9606.ENSP00000327290	0.670	Integrin alpha-11
20	9606.ENSP00000380227	0.670	Integrin alpha-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050839	1.000	cell adhesion molecule binding
GO:0044877	0.999	protein-containing complex binding
GO:0005102	0.999	signaling receptor binding
GO:0042802	0.973	identical protein binding
GO:0005178	0.927	integrin binding
GO:0097367	0.701	carbohydrate derivative binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.983	cellular process
GO:0051239	0.895	regulation of multicellular organismal process
GO:0032502	0.892	developmental process
GO:0048518	0.881	positive regulation of biological process
GO:0040012	0.872	regulation of locomotion
GO:0030154	0.850	cell differentiation
GO:0048856	0.848	anatomical structure development
GO:0032501	0.844	multicellular organismal process
GO:0007155	0.791	cell adhesion
GO:0007275	0.776	multicellular organism development
GO:0022603	0.761	regulation of anatomical structure morphogenesis
GO:0009653	0.713	anatomical structure morphogenesis
GO:2000145	0.699	regulation of cell motility
GO:1901342	0.669	regulation of vasculature development
GO:0030334	0.664	regulation of cell migration
GO:0051240	0.633	positive regulation of multicellular organismal process
GO:0045765	0.629	regulation of angiogenesis
GO:0030155	0.612	regulation of cell adhesion
GO:0048731	0.591	system development
GO:0051094	0.505	positive regulation of developmental process
GO:0050896	0.503	response to stimulus
GO:0031589	0.485	cell-substrate adhesion
GO:0007160	0.472	cell-matrix adhesion
GO:0048522	0.459	positive regulation of cellular process
GO:0071840	0.450	cellular component organization or biogenesis
GO:0016043	0.416	cellular component organization
GO:0048870	0.397	cell motility
GO:1903670	0.396	regulation of sprouting angiogenesis
GO:0007399	0.381	nervous system development
GO:0048519	0.358	negative regulation of biological process
GO:0048468	0.338	cell development
GO:0051716	0.331	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.999	cell periphery
GO:0031012	0.990	extracellular matrix
GO:0098636	0.989	protein complex involved in cell adhesion
GO:0062023	0.955	collagen-containing extracellular matrix
GO:0005886	0.953	plasma membrane
GO:0009986	0.787	cell surface
GO:0030054	0.688	cell junction
GO:0005576	0.571	extracellular region
GO:0098637	0.485	protein complex involved in cell-matrix adhesion
GO:0090733	0.366	tenascin complex
GO:0043226	0.358	organelle
GO:0043231	0.321	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]