StarFunc result for job id Q9UQQ2

User Input

>input (575 residues)
MNGPALQPSSPSSAPSASPAAAPRGWSEFCELHAVAAARELARQYWLFAREHPQHAPLRA
ELVSLQFTDLFQRYFCREVRDGRAPGRDYRDTGRGPPAKAEASPEPGPGPAAPGLPKARS
SEELAPPRPPGPCSFQHFRRSLRHIFRRRSAGELPAAHTAAAPGTPGEAAETPARPGLAK
KFLPWSLAREPPPEALKEAVLRYSLADEASMDSGARWQRGRLALRRAPGPDGPDRVLELF
DPPKSSRPKLQAACSSIQEVRWCTRLEMPDNLYTFVLKVKDRTDIIFEVGDEQQLNSWMA
ELSECTGRGLESTEAEMHIPSALEPSTSSSPRGSTDSLNQGASPGGLLDPACQKTDHFLS
CYPWFHGPISRVKAAQLVQLQGPDAHGVFLVRQSETRRGEYVLTFNFQGIAKHLRLSLTE
RGQCRVQHLHFPSVVDMLHHFQRSPIPLECGAACDVRLSSYVVVVSQPPGSCNTVLFPFS
LPHWDSESLPHWGSELGLPHLSSSGCPRGLSPEGLPGRSSPPEQIFHLVPSPEELANSLQ
HLEHEPVNRARDSDYEMDSSSRSHLRAIDNQYTPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UQQ2	0.999	0.999	2.233E-96	575	1.000	1.000	Q9UQQ2.pdb.gz	SH2B3_HUMAN SH2B adapter protein 3 OS=Homo sapiens OX=9606 GN=SH2B3 PE=1 SV=2
2	AFDB:Q62985	0.282	0.227	6.470E-35	756	0.381	0.290	Q62985.pdb.gz	SH2B1_RAT SH2B adapter protein 1 OS=Rattus norvegicus OX=10116 GN=Sh2b1 PE=1 SV=1
3	AFDB:O14492	0.198	0.181	1.024E-33	632	0.374	0.340	O14492.pdb.gz	SH2B2_HUMAN SH2B adapter protein 2 OS=Homo sapiens OX=9606 GN=SH2B2 PE=1 SV=2
4	PDB:4fl2A	0.129	0.134	3.363E-6	555	0.068	0.070	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
5	PDB:1ka6A	0.156	0.755	3.558E-6	107	0.049	0.262	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
6	AFDB:Q1RLN5	0.164	0.120	1.088E-5	799	0.061	0.044	Q1RLN5.pdb.gz	Q1RLN5_HUMAN ARHGAP12 protein OS=Homo sapiens OX=9606 GN=ARHGAP12 PE=1 SV=1
7	PDB:1griA	0.138	0.362	2.558E-5	211	0.037	0.100	1griA.pdb.gz
8	PDB:1k9aB	0.136	0.176	5.958E-5	441	0.043	0.057	1k9aB.pdb.gz
9	PDB:2h8hA	0.158	0.201	5.958E-5	445	0.047	0.061	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
10	PDB:8dcxB	0.161	0.367	9.352E-5	236	0.052	0.127	8dcxB.pdb.gz
11	PDB:2lqnA	0.125	0.232	1.468E-4	303	0.042	0.079	2lqnA.pdb.gz
12	PDB:5xzrA	0.155	0.171	1.468E-4	519	0.073	0.081	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
13	AFDB:O08587	0.153	0.186	1.538E-4	467	0.082	0.101	O08587.pdb.gz	NUP50_RAT Nuclear pore complex protein Nup50 OS=Rattus norvegicus OX=10116 GN=Nup50 PE=2 SV=2
14	PDB:3ps5A	0.159	0.171	2.304E-4	529	0.073	0.079	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
15	PDB:4gwfA	0.135	0.155	2.729E-4	497	0.033	0.038	4gwfA.pdb.gz
16	AFDB:A0A024R4X7	0.152	0.185	8.826E-4	468	0.071	0.088	A0A024R4X7.pdb.gz
17	AFDB:Q9QYY0	0.176	0.147	2.055E-3	695	0.103	0.085	Q9QYY0.pdb.gz	GAB1_MOUSE GRB2-associated-binding protein 1 OS=Mus musculus OX=10090 GN=Gab1 PE=1 SV=2
18	AFDB:Q93WT0	0.070	0.072	3.821E-3	538	0.123	0.132	Q93WT0.pdb.gz	WRK31_ARATH Probable WRKY transcription factor 31 OS=Arabidopsis thaliana OX=3702 GN=WRKY31 PE=1 SV=1
19	AFDB:Q9LXG8	0.077	0.079	5.065E-3	548	0.129	0.135	Q9LXG8.pdb.gz	WRK72_ARATH Probable WRKY transcription factor 72 OS=Arabidopsis thaliana OX=3702 GN=WRKY72 PE=2 SV=1
20	AFDB:Q6DFV3	0.162	0.059	9.414E-3	1944	0.087	0.026	Q6DFV3.pdb.gz	RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus OX=10090 GN=Arhgap21 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O09039	0.0	736	548	0.723	0.759	SH2B3_MOUSE SH2B adapter protein 3 OS=Mus musculus OX=10090 GN=Sh2b3 PE=1 SV=2
2	Q9UQQ2	0.0	1161	575	1.000	1.000	SH2B3_HUMAN SH2B adapter protein 3 OS=Homo sapiens OX=9606 GN=SH2B3 PE=1 SV=2
3	P50745	4.81e-127	379	368	0.350	0.546	SH2B3_RAT SH2B adapter protein 3 OS=Rattus norvegicus OX=10116 GN=Sh2b3 PE=1 SV=1
4	O14492	5.50e-72	244	632	0.332	0.302	SH2B2_HUMAN SH2B adapter protein 2 OS=Homo sapiens OX=9606 GN=SH2B2 PE=1 SV=2
5	Q9Z200	1.69e-69	237	621	0.343	0.317	SH2B2_RAT SH2B adapter protein 2 OS=Rattus norvegicus OX=10116 GN=Sh2b2 PE=1 SV=1
6	Q9JID9	3.44e-66	228	621	0.323	0.300	SH2B2_MOUSE SH2B adapter protein 2 OS=Mus musculus OX=10090 GN=Sh2b2 PE=1 SV=2
7	Q91ZM2	2.40e-42	164	756	0.151	0.115	SH2B1_MOUSE SH2B adapter protein 1 OS=Mus musculus OX=10090 GN=Sh2b1 PE=1 SV=2
8	Q62985	4.90e-42	163	756	0.150	0.114	SH2B1_RAT SH2B adapter protein 1 OS=Rattus norvegicus OX=10116 GN=Sh2b1 PE=1 SV=1
9	Q9NRF2	8.65e-42	162	756	0.137	0.104	SH2B1_HUMAN SH2B adapter protein 1 OS=Homo sapiens OX=9606 GN=SH2B1 PE=1 SV=3
10	Q9U8B9	2.41e-38	145	319	0.111	0.201	Q9U8B9_DROME Lnk-like protein (Fragment) OS=Drosophila melanogaster OX=7227 GN=Lnk PE=2 SV=2
11	A0A0B4LIP5	4.54e-37	147	608	0.111	0.105	A0A0B4LIP5_DROME Lnk, isoform F OS=Drosophila melanogaster OX=7227 GN=Lnk PE=3 SV=1
12	A0A0B4LHS0	4.84e-37	147	613	0.111	0.104	A0A0B4LHS0_DROME Lnk, isoform E OS=Drosophila melanogaster OX=7227 GN=Lnk PE=3 SV=1
13	A0A0B4LHY5	1.61e-36	147	728	0.111	0.088	A0A0B4LHY5_DROME Lnk, isoform D OS=Drosophila melanogaster OX=7227 GN=Lnk PE=3 SV=1
14	Q7K137	1.70e-36	147	723	0.111	0.089	Q7K137_DROME LD10453p OS=Drosophila melanogaster OX=7227 GN=Lnk PE=2 SV=1
15	C9JK89	7.80e-10	62.0	243	0.132	0.313	C9JK89_HUMAN SH2B adapter protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=SH2B2 PE=1 SV=3
16	O18683	1.79e-08	59.3	506	0.071	0.081	O18683_DROME LD42724p OS=Drosophila melanogaster OX=7227 GN=Pi3K21B PE=2 SV=3
17	Q7KTZ2	1.84e-08	59.3	496	0.071	0.083	Q7KTZ2_DROME Pi3K21B, isoform B OS=Drosophila melanogaster OX=7227 GN=Pi3K21B PE=1 SV=1
18	Q8IPW2	1.50e-07	56.2	410	0.049	0.068	Q8IPW2_DROME Dreadlocks, isoform A OS=Drosophila melanogaster OX=7227 GN=dock PE=1 SV=1
19	Q24218	1.51e-07	56.2	410	0.049	0.068	Q24218_DROME SH2/SH3 adaptor protein OS=Drosophila melanogaster OX=7227 GN=dock PE=1 SV=1
20	Q9VPU1	2.78e-07	55.8	548	0.049	0.051	Q9VPU1_DROME Dreadlocks, isoform B OS=Drosophila melanogaster OX=7227 GN=dock PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00169 PH	0.0061	28.4	PH domain
2	PF08916 Phe_ZIP	1.1e-17	75.7	Phenylalanine zipper
3	PF00017 SH2	3e-10	51.4	SH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345492

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000288135	0.998	Mast/stem cell growth factor receptor Kit
2	9606.ENSP00000371067	0.989	Tyrosine-protein kinase JAK2
3	9606.ENSP00000264033	0.962	E3 ubiquitin-protein ligase CBL
4	9606.ENSP00000376345	0.956	Growth factor receptor-bound protein 2
5	9606.ENSP00000222139	0.954	Erythropoietin receptor
6	9606.ENSP00000252723	0.939	Erythropoietin
7	9606.ENSP00000228280	0.927	Kit ligand
8	9606.ENSP00000330341	0.926	Suppressor of cytokine signaling 3
9	9606.ENSP00000321221	0.855	SH2B adapter protein 1
10	9606.ENSP00000354207	0.851	NT-3 growth factor receptor
11	9606.ENSP00000431418	0.843	High affinity nerve growth factor receptor
12	9606.ENSP00000277120	0.822	BDNF/NT-3 growth factors receptor
13	9606.ENSP00000241453	0.794	Receptor-type tyrosine-protein kinase FLT3
14	9606.ENSP00000361548	0.709	Thrombopoietin receptor
15	9606.ENSP00000347032	0.694	Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma
16	9606.ENSP00000379975	0.692	Integrin-linked protein kinase
17	9606.ENSP00000364839	0.681	Putative Polycomb group protein ASXL1
18	9606.ENSP00000257290	0.678	Platelet-derived growth factor receptor alpha
19	9606.ENSP00000352833	0.674	Tyrosine-protein phosphatase non-receptor type 22
20	9606.ENSP00000387122	0.665	Protein CLEC16A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.427	enzyme binding
GO:0005102	0.386	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0050896	0.988	response to stimulus
GO:0032501	0.974	multicellular organismal process
GO:0048856	0.967	anatomical structure development
GO:0009966	0.966	regulation of signal transduction
GO:0048519	0.964	negative regulation of biological process
GO:0048523	0.941	negative regulation of cellular process
GO:0051716	0.940	cellular response to stimulus
GO:0007154	0.937	cell communication
GO:0007166	0.930	cell surface receptor signaling pathway
GO:0030154	0.867	cell differentiation
GO:0002376	0.862	immune system process
GO:0030097	0.852	hemopoiesis
GO:0023057	0.824	negative regulation of signaling
GO:0042221	0.801	response to chemical
GO:0070887	0.791	cellular response to chemical stimulus
GO:0071310	0.750	cellular response to organic substance
GO:0048585	0.727	negative regulation of response to stimulus
GO:0009968	0.653	negative regulation of signal transduction
GO:0019222	0.626	regulation of metabolic process
GO:0048518	0.600	positive regulation of biological process
GO:0060255	0.456	regulation of macromolecule metabolic process
GO:0080090	0.425	regulation of primary metabolic process
GO:0031323	0.424	regulation of cellular metabolic process
GO:0051171	0.408	regulation of nitrogen compound metabolic process
GO:0019221	0.404	cytokine-mediated signaling pathway
GO:0048522	0.403	positive regulation of cellular process
GO:0042592	0.344	homeostatic process
GO:1904892	0.339	regulation of receptor signaling pathway via STAT
GO:0060759	0.313	regulation of response to cytokine stimulus
GO:1904893	0.307	negative regulation of receptor signaling pathway via STAT
GO:0048584	0.300	positive regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0071944	0.489	cell periphery
GO:0043226	0.458	organelle
GO:0005886	0.448	plasma membrane
GO:0043229	0.422	intracellular organelle
GO:0043227	0.381	membrane-bounded organelle
GO:0043231	0.369	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]