StarFunc result for job id Q9UQR1

User Input

>input (794 residues)
MNIDDKLEGLFLKCGGIDEMQSSRTMVVMGGVSGQSTVSGELQDSVLQDRSMPHQEILAA
DEVLQESEMRQQDMISHDELMVHEETVKNDEEQMETHERLPQGLQYALNVPISVKQEITF
TDVSEQLMRDKKQIREPVDLQKKKKRKQRSPAKILTINEDGSLGLKTPKSHVCEHCNAAF
RTNYHLQRHVFIHTGEKPFQCSQCDMRFIQKYLLQRHEKIHTGEKPFRCDECGMRFIQKY
HMERHKRTHSGEKPYQCEYCLQYFSRTDRVLKHKRMCHENHDKKLNRCAIKGGLLTSEED
SGFSTSPKDNSLPKKKRQKTEKKSSGMDKESALDKSDLKKDKNDYLPLYSSSTKVKDEYM
VAEYAVEMPHSSVGGSHLEDASGEIHPPKLVLKKINSKRSLKQPLEQNQTISPLSTYEES
KVSKYAFELVDKQALLDSEGNADIDQVDNLQEGPSKPVHSSTNYDDAMQFLKKKRYLQAA
SNNSREYALNVGTIASQPSVTQAAVASVIDESTTASILESQALNVEIKSNHDKNVIPDEV
LQTLLDHYSHKANGQHEISFSVADTEVTSSISINSSEVPEVTPSENVGSSSQASSSDKAN
MLQEYSKFLQQALDRTSQNDAYLNSPSLNFVTDNQTLPNQPAFSSIDKQVYATMPINSFR
SGMNSPLRTTPDKSHFGLIVGDSQHSFPFSGDETNHASATSTQDFLDQVTSQKKAEAQPV
HQAYQMSSFEQPFRAPYHGSRAGIATQFSTANGQVNLRGPGTSAEFSEFPLVNVNDNRAG
MTSSPDATTGQTFG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0MS83	0.178	0.175	5.761E-64	808	0.616	0.605	A0MS83.pdb.gz	ZN148_DANRE Zinc finger protein 148 OS=Danio rerio OX=7955 GN=znf148 PE=2 SV=2
2	AFDB:Q9Y2X9	0.154	0.139	2.564E-30	895	0.334	0.296	Q9Y2X9.pdb.gz	ZN281_HUMAN Zinc finger protein 281 OS=Homo sapiens OX=9606 GN=ZNF281 PE=1 SV=1
3	AFDB:Q9GRX2	0.115	0.116	9.204E-16	791	0.165	0.166	Q9GRX2.pdb.gz	Q9GRX2_DROME Heavy metal-responsive transcription factor-1 OS=Drosophila melanogaster OX=7227 GN=MTF-1 PE=2 SV=1
4	AFDB:P47806	0.138	0.102	2.016E-10	1111	0.184	0.131	P47806.pdb.gz	GLI1_MOUSE Zinc finger protein GLI1 OS=Mus musculus OX=10090 GN=Gli1 PE=1 SV=4
5	AFDB:A0A5K4F1D0	0.148	0.048	6.766E-10	2566	0.174	0.054	A0A5K4F1D0.pdb.gz	GLI1_SCHMA Zinc finger protein GLI1 OS=Schistosoma mansoni OX=6183 GN=gli1 PE=2 SV=1
6	AFDB:F1QPM7	0.111	0.088	1.279E-9	1078	0.165	0.122	F1QPM7.pdb.gz
7	AFDB:F1QAC4	0.144	0.085	1.759E-9	1404	0.180	0.102	F1QAC4.pdb.gz	F1QAC4_DANRE GLI family zinc finger 1 OS=Danio rerio OX=7955 GN=gli1 PE=3 SV=1
8	AFDB:P37275	0.088	0.069	1.875E-9	1124	0.184	0.130	P37275.pdb.gz	ZEB1_HUMAN Zinc finger E-box-binding homeobox 1 OS=Homo sapiens OX=9606 GN=ZEB1 PE=1 SV=2
9	AFDB:Q64318	0.113	0.087	1.048E-8	1117	0.181	0.129	Q64318.pdb.gz	ZEB1_MOUSE Zinc finger E-box-binding homeobox 1 OS=Mus musculus OX=10090 GN=Zeb1 PE=1 SV=1
10	AFDB:A0A1W2PQA1	0.092	0.072	1.268E-8	1069	0.162	0.121	A0A1W2PQA1.pdb.gz	A0A1W2PQA1_HUMAN RE1 silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=2
11	PDB:3w5kB	0.070	0.291	9.281E-5	110	0.047	0.336	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6wj2A	0.037	0.189	3.006	96	0.024	0.198	6wj2A.pdb.gz	Structural mechanism for amino acid-dependent Rag GTPase nucleotide state switching by SLC38A9.
13	PDB:7uhyC	0.029	0.038	4.696	578	0.018	0.024	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
14	PDB:1xcbA	0.031	0.079	5.685	205	0.019	0.073	1xcbA.pdb.gz	X-Ray Structure of a Rex-Family Repressor/NADH Complex: Insights into the Mechanism of Redox Sensing
15	PDB:1b71A	0.029	0.090	7.336	191	0.015	0.063	1b71A.pdb.gz	Alternative metal-binding sites in rubrerythrin.
16	PDB:4btsA9	0.034	0.155	7.336	93	0.020	0.172	4btsA9.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.
17	PDB:6yxxAf	0.049	0.123	7.818	139	0.024	0.137	6yxxAf.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
18	PDB:7qo48	0.049	0.079	7.818	372	0.015	0.032	7qo48.pdb.gz	Allosteric control of Ubp6 and the proteasome via a bidirectional switch.
19	PDB:6hlqI	0.024	0.117	9.465	111	0.019	0.135	6hlqI.pdb.gz	The cryo-EM structure of a 12-subunit variant of RNA polymerase I reveals dissociation of the A49-A34.5 heterodimer and rearrangement of subunit A12.2.
20	PDB:7dvqM	0.029	0.096	9.465	191	0.040	0.168	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0MS83	0.0	893	808	0.618	0.608	ZN148_DANRE Zinc finger protein 148 OS=Danio rerio OX=7955 GN=znf148 PE=2 SV=2
2	Q15552	0.0	865	454	0.520	0.910	Q15552_HUMAN CACCC box-binding protein OS=Homo sapiens OX=9606 GN=tb protein PE=2 SV=1
3	Q61624	0.0	1619	794	0.976	0.976	ZN148_MOUSE Zinc finger protein 148 OS=Mus musculus OX=10090 GN=Znf148 PE=1 SV=2
4	Q62806	0.0	1613	794	0.972	0.972	ZN148_RAT Zinc finger protein 148 OS=Rattus norvegicus OX=10116 GN=Znf148 PE=1 SV=1
5	Q9UQR1	0.0	1657	794	1.000	1.000	ZN148_HUMAN Zinc finger protein 148 OS=Homo sapiens OX=9606 GN=ZNF148 PE=1 SV=2
6	Q9Y2X9	2.45e-121	388	895	0.307	0.273	ZN281_HUMAN Zinc finger protein 281 OS=Homo sapiens OX=9606 GN=ZNF281 PE=1 SV=1
7	Q99LI5	1.28e-119	384	893	0.306	0.272	ZN281_MOUSE Zinc finger protein 281 OS=Mus musculus OX=10090 GN=Znf281 PE=1 SV=1
8	Q8NDX6	4.08e-37	139	193	0.083	0.342	ZN740_HUMAN Zinc finger protein 740 OS=Homo sapiens OX=9606 GN=ZNF740 PE=1 SV=1
9	Q9ERU2	1.74e-27	114	237	0.067	0.224	ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus OX=10116 GN=Znf22 PE=2 SV=2
10	Q9ERU3	2.14e-27	113	237	0.067	0.224	ZNF22_MOUSE Zinc finger protein 22 OS=Mus musculus OX=10090 GN=Znf22 PE=1 SV=2
11	Q96NJ6	1.24e-26	117	502	0.064	0.102	ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens OX=9606 GN=ZFP3 PE=1 SV=1
12	P17026	1.48e-26	110	224	0.064	0.228	ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens OX=9606 GN=ZNF22 PE=1 SV=3
13	I3L4J6	1.77e-26	115	435	0.073	0.133	I3L4J6_HUMAN Zinc finger protein 232 OS=Homo sapiens OX=9606 GN=ZNF232 PE=1 SV=1
14	Q9UNY5	2.30e-26	114	417	0.072	0.137	ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens OX=9606 GN=ZNF232 PE=1 SV=1
15	Q3USU9	2.36e-26	117	632	0.064	0.081	Q3USU9_MOUSE Zinc finger protein 251 OS=Mus musculus OX=10090 GN=Zfp251 PE=2 SV=1
16	Q6PCX8	2.43e-26	117	632	0.064	0.081	Q6PCX8_MOUSE Zinc finger protein 251 OS=Mus musculus OX=10090 GN=Zfp251 PE=2 SV=1
17	Q9UJW8	2.45e-26	117	692	0.068	0.078	ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens OX=9606 GN=ZNF180 PE=1 SV=2
18	P10073	2.55e-26	115	491	0.059	0.096	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
19	Q3V362	2.67e-26	117	622	0.064	0.082	Q3V362_MOUSE Zinc finger protein 251 (Fragment) OS=Mus musculus OX=10090 GN=Zfp251 PE=2 SV=1
20	Q96N20	4.90e-26	111	296	0.059	0.159	ZN75A_HUMAN Zinc finger protein 75A OS=Homo sapiens OX=9606 GN=ZNF75A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03604 DNA_RNApol_7kD	5.8e+02	11.6	DNA directed RNA polymerase, 7 kDa subunit
2	PF12773 DZR	8.3e+02	11.4	Double zinc ribbon
3	PF00096 zf-C2H2	9.4e-09	46.4	Zinc finger, C2H2 type
4	PF13894 zf-C2H2_4	5.7e-06	37.7	C2H2-type zinc finger
5	PF13465 zf-H2C2_2	3.2e-20	82.8	Zinc-finger double domain
6	PF01753 zf-MYND	97	14.5	MYND finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353863

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263253	0.981	Histone acetyltransferase p300
2	9606.ENSP00000351015	0.833	Neurofibromin
3	9606.ENSP00000362649	0.784	Histone deacetylase 1
4	9606.ENSP00000365858	0.761	Erythroid transcription factor
5	9606.ENSP00000278616	0.725	Serine-protein kinase ATM
6	9606.ENSP00000234111	0.724	Ornithine decarboxylase
7	9606.ENSP00000379898	0.684	ADP-ribosylation factor-like protein 4A
8	9606.ENSP00000253262	0.683	NUT family member 2F
9	9606.ENSP00000377655	0.653	Sentrin-specific protease 7
10	9606.ENSP00000358423	0.640	Ras-related GTP-binding protein D
11	9606.ENSP00000252996	0.634	Transcription initiation factor TFIID subunit 4
12	9606.ENSP00000269305	0.614	Cellular tumor antigen p53
13	9606.ENSP00000363944	0.614	Ribosomal biogenesis protein LAS1L
14	9606.ENSP00000349541	0.590	Caveolae-associated protein 1
15	9606.ENSP00000357122	0.559	Pyrin and HIN domain-containing protein 1
16	9606.ENSP00000337194	0.548	Serine/threonine-protein kinase PRP4 homolog
17	9606.ENSP00000326630	0.510	Zinc finger protein ZFPM1
18	9606.ENSP00000307833	0.504	F-box only protein 22
19	9606.ENSP00000352516	0.503	DNA (cytosine-5)-methyltransferase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981	0.988	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001217	0.929	DNA-binding transcription repressor activity
GO:0001227	0.919	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010468	0.998	regulation of gene expression
GO:0009889	0.997	regulation of biosynthetic process
GO:0019219	0.995	regulation of nucleobase-containing compound metabolic process
GO:0006357	0.986	regulation of transcription by RNA polymerase II
GO:0009987	0.875	cellular process
GO:0048519	0.769	negative regulation of biological process
GO:0048523	0.740	negative regulation of cellular process
GO:0010605	0.588	negative regulation of macromolecule metabolic process
GO:0045934	0.581	negative regulation of nucleobase-containing compound metabolic process
GO:0010558	0.577	negative regulation of macromolecule biosynthetic process
GO:0031327	0.577	negative regulation of cellular biosynthetic process
GO:0048518	0.573	positive regulation of biological process
GO:1902679	0.561	negative regulation of RNA biosynthetic process
GO:0048522	0.556	positive regulation of cellular process
GO:0045892	0.552	negative regulation of DNA-templated transcription
GO:0009893	0.468	positive regulation of metabolic process
GO:0010604	0.387	positive regulation of macromolecule metabolic process
GO:0032501	0.379	multicellular organismal process
GO:0051173	0.368	positive regulation of nitrogen compound metabolic process
GO:0031325	0.368	positive regulation of cellular metabolic process
GO:0045935	0.358	positive regulation of nucleobase-containing compound metabolic process
GO:0000122	0.338	negative regulation of transcription by RNA polymerase II
GO:0045893	0.321	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.977	nuclear lumen
GO:0005654	0.958	nucleoplasm
GO:0005737	0.718	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]