StarFunc result for job id Q9UQV4

User Input

>input (416 residues)
MPRQLSAAAALFASLAVILHDGSQMRAKAFPETRDYSQPTAAATVQDIKKPVQQPAKQAP
HQTLAARFMDGHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPV
TEVTVGPSLAPYSLPPTITPPAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKST
TGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKA
EMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEES
YYISEVGAYLTVSDPETIYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQL
QAFDFEDDHFGNVDECSSDYTIVLPVIGAIVVGLCLMGMGVYKIRLRCQSSGYQRI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UQV4	1.000	1.000	5.916E-62	416	1.000	1.000	Q9UQV4.pdb.gz	LAMP3_HUMAN Lysosome-associated membrane glycoprotein 3 OS=Homo sapiens OX=9606 GN=LAMP3 PE=1 SV=3
2	AFDB:Q7TST5	0.519	0.525	1.925E-37	411	0.529	0.535	Q7TST5.pdb.gz	LAMP3_MOUSE Lysosome-associated membrane glycoprotein 3 OS=Mus musculus OX=10090 GN=Lamp3 PE=2 SV=1
3	AFDB:Q5XI99	0.526	0.536	8.969E-35	408	0.522	0.532	Q5XI99.pdb.gz	LAMP3_RAT Lysosome-associated membrane glycoprotein 3 OS=Rattus norvegicus OX=10116 GN=Lamp3 PE=2 SV=1
4	AFDB:P08575	0.141	0.057	3.314E-3	1306	0.163	0.052	P08575.pdb.gz	PTPRC_HUMAN Receptor-type tyrosine-protein phosphatase C OS=Homo sapiens OX=9606 GN=PTPRC PE=1 SV=3
5	PDB:5w5yO	0.087	0.065	6.228E-3	640	0.062	0.041	5w5yO.pdb.gz	Structural mechanism of ATP-independent transcription initiation by RNA polymerase I.
6	PDB:8h16A	0.061	0.041	6.831E-2	805	0.043	0.022	8h16A.pdb.gz
7	PDB:3o12A	0.077	0.119	7.197E-2	185	0.053	0.119	3o12A.pdb.gz
8	AFDB:Q7DD37	0.112	0.098	8.363E-2	488	0.115	0.098	Q7DD37.pdb.gz	NHBA_NEIMB Neisserial heparin binding antigen OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=nhba PE=1 SV=1
9	AFDB:D0QMC3	0.090	0.074	1.143E-1	538	0.106	0.082	D0QMC3.pdb.gz	MNDAL_MOUSE Myeloid cell nuclear differentiation antigen-like protein OS=Mus musculus OX=10090 GN=Mndal PE=1 SV=1
10	AFDB:Q9W0L9	0.098	0.084	1.143E-1	525	0.115	0.091	Q9W0L9.pdb.gz	Q9W0L9_DROME Defective proboscis extension response 20 OS=Drosophila melanogaster OX=7227 GN=dpr20 PE=1 SV=1
11	PDB:6dbjD	0.100	0.113	1.211E-1	352	0.050	0.060	6dbjD.pdb.gz	DNA melting initiates the RAG catalytic pathway.
12	PDB:5jowA	0.078	0.069	1.276E-1	504	0.043	0.036	5jowA.pdb.gz
13	PDB:6nb7B	0.070	0.038	1.492E-1	1032	0.036	0.015	6nb7B.pdb.gz
14	PDB:6rqhS	0.098	0.073	1.935E-1	610	0.053	0.036	6rqhS.pdb.gz	Molecular insight into RNA polymerase I promoter recognition and promoter melting.
15	AFDB:A0A0A0MRA8	0.062	0.035	2.027E-1	918	0.115	0.052	A0A0A0MRA8.pdb.gz	A0A0A0MRA8_HUMAN Erythrocyte membrane protein band 4.1 like 3 OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=1
16	PDB:6jxrm	0.089	0.137	2.039E-1	248	0.060	0.101	6jxrm.pdb.gz
17	PDB:2w7qA	0.106	0.171	2.148E-1	192	0.024	0.052	2w7qA.pdb.gz
18	AFDB:P08553	0.082	0.046	2.249E-1	848	0.077	0.038	P08553.pdb.gz	NFM_MOUSE Neurofilament medium polypeptide OS=Mus musculus OX=10090 GN=Nefm PE=1 SV=4
19	AFDB:F4I316	0.097	0.072	2.496E-1	660	0.137	0.086	F4I316.pdb.gz	SUN3_ARATH SUN domain-containing protein 3 OS=Arabidopsis thaliana OX=3702 GN=SUN3 PE=1 SV=1
20	PDB:3w1zB	0.079	0.149	2.511E-1	143	0.014	0.042	3w1zB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7ETP9	0.0	801	392	0.942	1.000	E7ETP9_HUMAN Lysosomal associated membrane protein 3 OS=Homo sapiens OX=9606 GN=LAMP3 PE=1 SV=1
2	Q9UQV4	0.0	848	416	1.000	1.000	LAMP3_HUMAN Lysosome-associated membrane glycoprotein 3 OS=Homo sapiens OX=9606 GN=LAMP3 PE=1 SV=3
3	Q7TST5	5.81e-136	397	411	0.534	0.540	LAMP3_MOUSE Lysosome-associated membrane glycoprotein 3 OS=Mus musculus OX=10090 GN=Lamp3 PE=2 SV=1
4	Q5XI99	4.60e-116	347	408	0.534	0.544	LAMP3_RAT Lysosome-associated membrane glycoprotein 3 OS=Rattus norvegicus OX=10116 GN=Lamp3 PE=2 SV=1
5	P05300	1.63e-18	89.0	414	0.178	0.179	LAMP1_CHICK Lysosome-associated membrane glycoprotein 1 OS=Gallus gallus OX=9031 GN=LAMP1 PE=2 SV=1
6	P14562	4.27e-18	87.8	407	0.240	0.246	LAMP1_RAT Lysosome-associated membrane glycoprotein 1 OS=Rattus norvegicus OX=10116 GN=Lamp1 PE=1 SV=1
7	P11438	5.07e-18	87.4	406	0.144	0.148	LAMP1_MOUSE Lysosome-associated membrane glycoprotein 1 OS=Mus musculus OX=10090 GN=Lamp1 PE=1 SV=2
8	Q05204	2.37e-17	85.5	409	0.151	0.154	LAMP1_BOVIN Lysosome-associated membrane glycoprotein 1 OS=Bos taurus OX=9913 GN=LAMP1 PE=1 SV=2
9	Q5BKX3	4.76e-17	84.3	355	0.132	0.155	Q5BKX3_DANRE Lysosomal membrane glycoprotein 2 OS=Danio rerio OX=7955 GN=sb:cb587 PE=1 SV=1
10	P13473	8.85e-17	84.0	410	0.130	0.132	LAMP2_HUMAN Lysosome-associated membrane glycoprotein 2 OS=Homo sapiens OX=9606 GN=LAMP2 PE=1 SV=2
11	P49129	4.27e-16	81.6	407	0.142	0.145	LAMP1_CRIGR Lysosome-associated membrane glycoprotein 1 OS=Cricetulus griseus OX=10029 GN=LAMP1 PE=2 SV=1
12	P11279	4.68e-16	81.6	417	0.139	0.139	LAMP1_HUMAN Lysosome-associated membrane glycoprotein 1 OS=Homo sapiens OX=9606 GN=LAMP1 PE=1 SV=3
13	A0A0R4IZ00	5.30e-16	80.9	356	0.123	0.143	A0A0R4IZ00_DANRE Lysosomal-associated membrane protein 2 OS=Danio rerio OX=7955 GN=sb:cb587 PE=1 SV=2
14	P17047	3.00e-15	79.3	415	0.132	0.133	LAMP2_MOUSE Lysosome-associated membrane glycoprotein 2 OS=Mus musculus OX=10090 GN=Lamp2 PE=1 SV=2
15	P17046	3.09e-13	73.2	411	0.130	0.131	LAMP2_RAT Lysosome-associated membrane glycoprotein 2 OS=Rattus norvegicus OX=10116 GN=Lamp2 PE=1 SV=3
16	A0A2R8Q0I4	8.79e-13	71.2	358	0.123	0.142	A0A2R8Q0I4_DANRE Lysosomal-associated membrane protein 2 OS=Danio rerio OX=7955 GN=sb:cb587 PE=1 SV=1
17	P31996	1.25e-09	61.6	326	0.185	0.236	CD68_MOUSE Macrosialin OS=Mus musculus OX=10090 GN=Cd68 PE=1 SV=1
18	Q4FZY1	1.15e-05	49.3	330	0.115	0.145	Q4FZY1_RAT Cd68 molecule OS=Rattus norvegicus OX=10116 GN=Cd68 PE=1 SV=1
19	P34756	0.019	40.0	2278	0.079	0.014	FAB1_YEAST 1-phosphatidylinositol 3-phosphate 5-kinase FAB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FAB1 PE=1 SV=3
20	O88427	0.059	38.5	2365	0.115	0.020	CAC1H_MOUSE Voltage-dependent T-type calcium channel subunit alpha-1H OS=Mus musculus OX=10090 GN=Cacna1h PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01299 Lamp	2.1e-42	156.0	Lysosome-associated membrane glycoprotein (Lamp)
2	PF05827 VAS1_LD	82	14.9	V-type proton ATPase subunit S1, luminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265598

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000250092	0.840	Macrosialin
2	9606.ENSP00000333298	0.825	Lysosome-associated membrane glycoprotein 1
3	9606.ENSP00000368450	0.714	CD83 antigen
4	9606.ENSP00000357152	0.681	T-cell surface glycoprotein CD1c
5	9606.ENSP00000315477	0.664	CD209 antigen
6	9606.ENSP00000289429	0.662	T-cell surface glycoprotein CD1a
7	9606.ENSP00000357149	0.661	T-cell surface glycoprotein CD1e, membrane-associated
8	9606.ENSP00000357150	0.661	T-cell surface glycoprotein CD1b
9	9606.ENSP00000386378	0.636	C-type lectin domain family 4 member K
10	9606.ENSP00000357153	0.611	Antigen-presenting glycoprotein CD1d
11	9606.ENSP00000263636	0.586	Lymphocyte antigen 75
12	9606.ENSP00000246657	0.572	C-C chemokine receptor type 7
13	9606.ENSP00000332049	0.567	T-lymphocyte activation antigen CD86
14	9606.ENSP00000264246	0.543	T-lymphocyte activation antigen CD80
15	9606.ENSP00000454623	0.523	Integrin alpha-X
16	9606.ENSP00000386559	0.517	T-cell surface glycoprotein CD8 alpha chain
17	9606.ENSP00000327890	0.501	Interleukin-3 receptor subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.992	response to stimulus
GO:0050794	0.986	regulation of cellular process
GO:0050792	0.985	regulation of viral process
GO:0051246	0.985	regulation of protein metabolic process
GO:0045861	0.980	negative regulation of proteolysis
GO:0044092	0.979	negative regulation of molecular function
GO:0009894	0.976	regulation of catabolic process
GO:0048518	0.974	positive regulation of biological process
GO:1903900	0.957	regulation of viral life cycle
GO:0051336	0.956	regulation of hydrolase activity
GO:0010941	0.952	regulation of cell death
GO:0042221	0.950	response to chemical
GO:0010604	0.948	positive regulation of macromolecule metabolic process
GO:0010466	0.947	negative regulation of peptidase activity
GO:0052548	0.942	regulation of endopeptidase activity
GO:0042981	0.933	regulation of apoptotic process
GO:0010951	0.926	negative regulation of endopeptidase activity
GO:2000116	0.910	regulation of cysteine-type endopeptidase activity
GO:1903050	0.907	regulation of proteolysis involved in protein catabolic process
GO:0060548	0.884	negative regulation of cell death
GO:2000117	0.881	negative regulation of cysteine-type endopeptidase activity
GO:0031323	0.877	regulation of cellular metabolic process
GO:0009987	0.838	cellular process
GO:0010033	0.823	response to organic substance
GO:0043066	0.823	negative regulation of apoptotic process
GO:0043281	0.818	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0009895	0.781	negative regulation of catabolic process
GO:0043154	0.759	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0010468	0.708	regulation of gene expression
GO:0034097	0.661	response to cytokine
GO:0010628	0.564	positive regulation of gene expression
GO:0031329	0.512	regulation of cellular catabolic process
GO:0042176	0.509	regulation of protein catabolic process
GO:0042177	0.492	negative regulation of protein catabolic process
GO:1903051	0.488	negative regulation of proteolysis involved in protein catabolic process
GO:0048522	0.450	positive regulation of cellular process
GO:0061136	0.378	regulation of proteasomal protein catabolic process
GO:0051716	0.364	cellular response to stimulus
GO:0010506	0.343	regulation of autophagy

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005737	0.998	cytoplasm
GO:0016020	0.997	membrane
GO:0012505	0.997	endomembrane system
GO:0005886	0.985	plasma membrane
GO:0031090	0.955	organelle membrane
GO:0031982	0.933	vesicle
GO:0098588	0.929	bounding membrane of organelle
GO:0031410	0.924	cytoplasmic vesicle
GO:0005768	0.836	endosome
GO:0098852	0.726	lytic vacuole membrane
GO:0005765	0.723	lysosomal membrane
GO:0005769	0.565	early endosome
GO:0012506	0.550	vesicle membrane
GO:0048471	0.499	perinuclear region of cytoplasm
GO:0030659	0.474	cytoplasmic vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]