StarFunc result for job id Q9Y210

User Input

>input (931 residues)
MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDSELGEDGCPQAPLPCYGYYPCFRGS
DNRLAHRRQTVLREKGRRLANRGPAYMFSDRSTSLSIEEERFLDAAEYGNIPVVRKMLEE
CHSLNVNCVDYMGQNALQLAVANEHLEITELLLKKENLSRVGDALLLAISKGYVRIVEAI
LSHPAFAEGKRLATSPSQSELQQDDFYAYDEDGTRFSHDVTPIILAAHCQEYEIVHTLLR
KGARIERPHDYFCKCNDCNQKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALEL
SNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCRNTEEVEAILNGDVETLQSGDHGR
PNLSRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLRQQTMAVKFLVVLAVAIGLPFL
ALIYWFAPCSKMGKIMRGPFMKFVAHAASFTIFLGLLVMNAADRFEGTKLLPNETSTDNA
KQLFRMKTSCFSWMEMLIISWVIGMIWAECKEIWTQGPKEYLFELWNMLDFGMLAIFAAS
FIARFMAFWHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWDPSDPQIISEGLYA
IAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYYI
GAKQNEAFTTVEESFKTLFWAIFGLSEVKSVVINYNHKFIENIGYVLYGVYNVTMVIVLL
NMLIAMINSSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLVPSPKSLFYLLLKL
KKWISELFQGHKKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSS
EDFHLNSFNNPPRQYQKIMKRLIKRYVLQAQIDKESDEVNEGELKEIKQDISSLRYELLE
EKSQNTEDLAELIRELGEKLSMEPNQEETNR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y210	1.000	1.000	0.000	931	1.000	1.000	Q9Y210.pdb.gz	TRPC6_HUMAN Short transient receptor potential channel 6 OS=Homo sapiens OX=9606 GN=TRPC6 PE=1 SV=1
2	AFDB:F1LQF7	0.842	0.908	5.060E-85	862	0.686	0.741	F1LQF7.pdb.gz	F1LQF7_RAT Transient receptor potential cation channel, subfamily C, member 7 OS=Rattus norvegicus OX=10116 GN=Trpc7 PE=4 SV=2
3	AFDB:G1U2U3	0.835	0.786	5.204E-83	991	0.679	0.638	G1U2U3.pdb.gz	G1U2U3_RABIT Transient receptor potential cation channel subfamily C member 3 OS=Oryctolagus cuniculus OX=9986 GN=TRPC3 PE=1 SV=2
4	PDB:6uz8A	0.743	0.934	2.306E-74	734	0.783	0.993	6uz8A.pdb.gz	Structural basis for pharmacological modulation of the TRPC6 channel.
5	PDB:7dxgA	0.698	0.919	7.521E-73	698	0.748	0.997	7dxgA.pdb.gz	Structural mechanism of human TRPC3 and TRPC6 channel regulation by their intracellular calcium-binding sites.
6	PDB:7dxbA	0.743	0.928	1.838E-69	738	0.634	0.799	7dxbA.pdb.gz	Structural mechanism of human TRPC3 and TRPC6 channel regulation by their intracellular calcium-binding sites.
7	PDB:5yx9A	0.672	0.911	2.698E-60	675	0.724	0.999	5yx9A.pdb.gz
8	PDB:5zbgA	0.676	0.928	4.242E-56	670	0.592	0.822	5zbgA.pdb.gz
9	AFDB:Q9QX29	0.691	0.661	6.731E-45	975	0.333	0.318	Q9QX29.pdb.gz	TRPC5_MOUSE Short transient receptor potential channel 5 OS=Mus musculus OX=10090 GN=Trpc5 PE=1 SV=2
10	AFDB:O35119	0.702	0.670	8.205E-45	977	0.344	0.328	O35119.pdb.gz	TRPC4_RAT Short transient receptor potential channel 4 OS=Rattus norvegicus OX=10116 GN=Trpc4 PE=1 SV=2
11	AFDB:Q9VJJ7	0.704	0.585	8.881E-45	1128	0.342	0.282	Q9VJJ7.pdb.gz	TRPG_DROME Transient receptor potential-gamma protein OS=Drosophila melanogaster OX=7227 GN=Trpgamma PE=1 SV=2
12	AFDB:A0A0R4IM91	0.689	0.701	9.240E-45	915	0.336	0.342	A0A0R4IM91.pdb.gz	A0A0R4IM91_DANRE Transient receptor potential cation channel, subfamily C, member 4b OS=Danio rerio OX=7955 GN=trpc4a PE=4 SV=1
13	AFDB:Q9R244	0.711	0.570	4.478E-43	1172	0.334	0.265	Q9R244.pdb.gz	TRPC2_MOUSE Short transient receptor potential channel 2 OS=Mus musculus OX=10090 GN=Trpc2 PE=2 SV=2
14	AFDB:E1U7G1	0.685	0.795	1.158E-42	796	0.304	0.356	E1U7G1.pdb.gz	E1U7G1_DANRE Short transient receptor potential channel 1 OS=Danio rerio OX=7955 GN=trpc1 PE=2 SV=1
15	AFDB:Q9PRI8	0.679	0.805	2.558E-42	778	0.300	0.359	Q9PRI8.pdb.gz	Q9PRI8_XENLA Short transient receptor potential channel 1 OS=Xenopus laevis OX=8355 GN=trpc1.L PE=2 SV=1
16	PDB:7b0jA	0.635	0.853	7.292E-40	682	0.319	0.435	7b0jA.pdb.gz	Structural basis of TRPC4 regulation by calmodulin and pharmacological agents.
17	PDB:7b1gA	0.638	0.847	2.185E-37	691	0.325	0.438	7b1gA.pdb.gz	Structural basis of TRPC4 regulation by calmodulin and pharmacological agents.
18	PDB:6ysnA	0.566	0.857	1.133E-33	606	0.279	0.429	6ysnA.pdb.gz	Human TRPC5 structures reveal interaction of a xanthine-based TRPC1/4/5 inhibitor with a conserved lipid binding site.
19	PDB:7a6uA	0.280	0.767	4.353E-26	332	0.294	0.825	7a6uA.pdb.gz
20	PDB:5vkqA	0.387	0.252	6.687E-18	1499	0.166	0.103	5vkqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6ATX7	0.0	1258	800	0.657	0.765	A0A8I6ATX7_RAT Transient receptor potential cation channel, subfamily C, member 7 OS=Rattus norvegicus OX=10116 GN=Trpc7 PE=4 SV=1
2	A0A8I6GIE6	0.0	1191	807	0.641	0.740	A0A8I6GIE6_RAT Transient receptor potential cation channel, subfamily C, member 7 OS=Rattus norvegicus OX=10116 GN=Trpc7 PE=4 SV=1
3	A0A8I6GIF7	0.0	1161	801	0.623	0.724	A0A8I6GIF7_RAT Transient receptor potential cation channel, subfamily C, member 7 OS=Rattus norvegicus OX=10116 GN=Trpc7 PE=4 SV=1
4	F1LQF7	0.0	1329	862	0.692	0.747	F1LQF7_RAT Transient receptor potential cation channel, subfamily C, member 7 OS=Rattus norvegicus OX=10116 GN=Trpc7 PE=4 SV=2
5	F7EUD8	0.0	708	406	0.369	0.847	F7EUD8_RAT Transient receptor ion channel domain-containing protein OS=Rattus norvegicus OX=10116 GN=Trpc6 PE=1 SV=1
6	G1U2U3	0.0	1278	991	0.673	0.633	G1U2U3_RABIT Transient receptor potential cation channel subfamily C member 3 OS=Oryctolagus cuniculus OX=9986 GN=TRPC3 PE=1 SV=2
7	Q13507	0.0	1280	921	0.675	0.682	TRPC3_HUMAN Short transient receptor potential channel 3 OS=Homo sapiens OX=9606 GN=TRPC3 PE=1 SV=4
8	Q61143	0.0	1784	930	0.936	0.937	TRPC6_MOUSE Short transient receptor potential channel 6 OS=Mus musculus OX=10090 GN=Trpc6 PE=1 SV=3
9	Q99N78	0.0	1788	930	0.939	0.940	Q99N78_RAT Transient receptor potential Ca2+ channel 6A OS=Rattus norvegicus OX=10116 GN=Trpc6 PE=1 SV=1
10	Q9HCX4	0.0	1328	862	0.692	0.747	TRPC7_HUMAN Short transient receptor potential channel 7 OS=Homo sapiens OX=9606 GN=TRPC7 PE=1 SV=1
11	Q9JMI9	0.0	1256	909	0.665	0.681	TRPC3_RAT Short transient receptor potential channel 3 OS=Rattus norvegicus OX=10116 GN=Trpc3 PE=2 SV=4
12	Q9QZC1	0.0	1257	910	0.665	0.680	TRPC3_MOUSE Short transient receptor potential channel 3 OS=Mus musculus OX=10090 GN=Trpc3 PE=1 SV=2
13	Q9VJJ7	0.0	559	1128	0.348	0.287	TRPG_DROME Transient receptor potential-gamma protein OS=Drosophila melanogaster OX=7227 GN=Trpgamma PE=1 SV=2
14	Q9WVC5	0.0	1333	862	0.695	0.751	TRPC7_MOUSE Short transient receptor potential channel 7 OS=Mus musculus OX=10090 GN=Trpc7 PE=2 SV=1
15	Q9Y210	0.0	1937	931	1.000	1.000	TRPC6_HUMAN Short transient receptor potential channel 6 OS=Homo sapiens OX=9606 GN=TRPC6 PE=1 SV=1
16	A0A0R4IM91	6.51e-177	538	915	0.346	0.352	A0A0R4IM91_DANRE Transient receptor potential cation channel, subfamily C, member 4b OS=Danio rerio OX=7955 GN=trpc4a PE=4 SV=1
17	U3N7D8	1.03e-176	538	915	0.347	0.353	U3N7D8_DANRE Transient receptor potential cation channel subfamily c member 4a OS=Danio rerio OX=7955 GN=trpc4a PE=1 SV=1
18	Q8VD38	5.78e-175	535	974	0.335	0.320	Q8VD38_RAT Transient receptor potential cation channel subfamily C member 5 OS=Rattus norvegicus OX=10116 GN=Trpc5 PE=2 SV=1
19	Q9QX29	9.40e-175	535	975	0.335	0.320	TRPC5_MOUSE Short transient receptor potential channel 5 OS=Mus musculus OX=10090 GN=Trpc5 PE=1 SV=2
20	Q9UL62	3.45e-172	528	973	0.334	0.320	TRPC5_HUMAN Short transient receptor potential channel 5 OS=Homo sapiens OX=9606 GN=TRPC5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	11	17.8	Ankyrin repeat
2	PF12796 Ank_2	1.1e-07	43.7	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	0.59	21.7	Ankyrin repeat
4	PF13637 Ank_4	0.049	25.5	Ankyrin repeats (many copies)
5	PF13857 Ank_5	0.61	21.7	Ankyrin repeats (many copies)
6	PF02045 CBFB_NFYA	3.6e+02	13.2	CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B
7	PF12998 ING	1.2e+02	14.7	Inhibitor of growth proteins N-terminal histone-binding
8	PF00520 Ion_trans	8.5e-32	121.9	Ion transport protein
9	PF08016 PKD_channel	1.4e-10	52.5	Polycystin cation channel
10	PF08344 TRP_2	1.5e-23	94.0	Transient receptor ion channel II

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000340913

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356587	0.998	Podocin
2	9606.ENSP00000368190	0.998	Nephrin
3	9606.ENSP00000286548	0.950	Guanine nucleotide-binding protein G(q) subunit alpha
4	9606.ENSP00000352138	0.944	Kin of IRRE-like protein 1
5	9606.ENSP00000406191	0.936	Transient receptor potential cation channel subfamily V member 4
6	9606.ENSP00000078429	0.923	Guanine nucleotide-binding protein subunit alpha-11
7	9606.ENSP00000348752	0.923	Protein orai-2
8	9606.ENSP00000365807	0.923	Guanine nucleotide-binding protein subunit alpha-14
9	9606.ENSP00000262958	0.913	Guanine nucleotide-binding protein subunit alpha-15
10	9606.ENSP00000363435	0.911	Inositol 1,4,5-trisphosphate receptor type 3
11	9606.ENSP00000383003	0.900	Peptidyl-prolyl cis-trans isomerase FKBP1A
12	9606.ENSP00000478059	0.898	Stromal interaction molecule 1
13	9606.ENSP00000363092	0.892	cGMP-dependent protein kinase 1
14	9606.ENSP00000480616	0.858	Calcium release-activated calcium channel protein 1
15	9606.ENSP00000388550	0.851	RING finger protein 24
16	9606.ENSP00000363708	0.848	Bone morphogenetic protein receptor type-2
17	9606.ENSP00000003084	0.836	Cystic fibrosis transmembrane conductance regulator
18	9606.ENSP00000368966	0.821	Short transient receptor potential channel 3
19	9606.ENSP00000342222	0.819	Transient receptor potential cation channel subfamily V member 2
20	9606.ENSP00000244007	0.806	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005262	0.999	calcium channel activity
GO:0043178	0.927	alcohol binding
GO:0043167	0.771	ion binding
GO:0043168	0.744	anion binding
GO:0070679	0.573	inositol 1,4,5 trisphosphate binding
GO:0042802	0.339	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0009987	0.990	cellular process
GO:0050789	0.989	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0006812	0.981	monoatomic cation transport
GO:0007204	0.979	positive regulation of cytosolic calcium ion concentration
GO:0071702	0.906	organic substance transport
GO:0048518	0.900	positive regulation of biological process
GO:0030001	0.900	metal ion transport
GO:0098660	0.898	inorganic ion transmembrane transport
GO:0050896	0.877	response to stimulus
GO:0048522	0.870	positive regulation of cellular process
GO:0006816	0.840	calcium ion transport
GO:0098662	0.764	inorganic cation transmembrane transport
GO:0098655	0.761	monoatomic cation transmembrane transport
GO:0032879	0.731	regulation of localization
GO:0070588	0.706	calcium ion transmembrane transport
GO:0043269	0.700	regulation of monoatomic ion transport
GO:0051050	0.571	positive regulation of transport
GO:0032501	0.568	multicellular organismal process
GO:0051716	0.559	cellular response to stimulus
GO:0065009	0.519	regulation of molecular function
GO:0043270	0.459	positive regulation of monoatomic ion transport
GO:0044093	0.369	positive regulation of molecular function
GO:0019222	0.368	regulation of metabolic process
GO:0042221	0.331	response to chemical
GO:0048519	0.323	negative regulation of biological process
GO:0032502	0.320	developmental process
GO:0034765	0.319	regulation of monoatomic ion transmembrane transport
GO:0010959	0.312	regulation of metal ion transport
GO:0048856	0.307	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.942	intracellular anatomical structure
GO:0005737	0.909	cytoplasm
GO:0043226	0.555	organelle
GO:0043229	0.543	intracellular organelle
GO:0043231	0.303	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	0.999	Ca(2+)(in) = Ca(2+)(out)

[back to server]