StarFunc result for job id Q9Y219

User Input

>input (1238 residues)
MRAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCDGDGRTTRAG
GCGHDECDTYVRVCLKEYQAKVTPTGPCSYGHGATPVLGGNSFYLPPAGAAGDRARARAR
AGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKS
LHFSGHVAHLELQIRVRCDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKEC
KEAVCKQGCNLLHGGCTVPGECRCSYGWQGRFCDECVPYPGCVHGSCVEPWQCNCETNWG
GLLCDKDLNYCGSHHPCTNGGTCINAEPDQYRCTCPDGYSGRNCEKAEHACTSNPCANGG
SCHEVPSGFECHCPSGWSGPTCALDIDECASNPCAAGGTCVDQVDGFECICPEQWVGATC
QLDANECEGKPCLNAFSCKNLIGGYYCDCIPGWKGINCHINVNDCRGQCQHGGTCKDLVN
GYQCVCPRGFGGRHCELERDECASSPCHSGGLCEDLADGFHCHCPQGFSGPLCEVDVDLC
EPSPCRNGARCYNLEGDYYCACPDDFGGKNCSVPREPCPGGACRVIDGCGSDAGPGMPGT
AASGVCGPHGRCVSQPGGNFSCICDSGFTGTYCHENIDDCLGQPCRNGGTCIDEVDAFRC
FCPSGWEGELCDTNPNDCLPDPCHSRGRCYDLVNDFYCACDDGWKGKTCHSREFQCDAYT
CSNGGTCYDSGDTFRCACPPGWKGSTCAVAKNSSCLPNPCVNGGTCVGSGASFSCICRDG
WEGRTCTHNTNDCNPLPCYNGGICVDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGA
TCVDEINGYRCSCPPGRAGPRCQEVIGFGRSCWSRGTPFPHGSSWVEDCNSCRCLDGRRD
CSKVWCGWKPCLLAGQPEALSAQCPLGQRCLEKAPGQCLRPPCEAWGECGAEEPPSTPCL
PRSGHLDNNCARLTLHFNRDHVPQGTTVGAICSGIRSLPATRAVARDRLLVLLCDRASSG
ASAVEVAVSFSPARDLPDSSLIQGAAHAIVAAITQRGNSSLLLAVTEVKVETVVTGGSST
GLLVPVLCGAFSVLWLACVVLCVWWTRKRRKERERSRLPREESANNQWAPLNPIRNPIER
PGGHKDVLYQCKNFTPPPRRADEALPGPAGHAAVREDEEDEDLGRGEEDSLEAEKFLSHK
FTKDPGRSPGRPAHWASGPKVDNRAVRSINEARYAGKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IAF3	0.360	0.356	0.000	1254	0.587	0.580	A0A0R4IAF3.pdb.gz
2	AFDB:A0A2R8QT22	0.543	0.552	0.000	1216	0.567	0.577	A0A2R8QT22.pdb.gz
3	AFDB:Q90Y57	0.338	0.337	0.000	1242	0.491	0.490	Q90Y57.pdb.gz	JAG1A_DANRE Protein jagged-1a OS=Danio rerio OX=7955 GN=jag1a PE=2 SV=1
4	AFDB:Q9QYE5	0.440	0.438	0.000	1247	0.905	0.898	Q9QYE5.pdb.gz	JAG2_MOUSE Protein jagged-2 OS=Mus musculus OX=10090 GN=Jag2 PE=2 SV=2
5	AFDB:F1QCA7	0.108	0.068	4.914E-65	2465	0.263	0.132	F1QCA7.pdb.gz
6	AFDB:Q01705	0.113	0.062	3.771E-64	2531	0.259	0.127	Q01705.pdb.gz	NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus musculus OX=10090 GN=Notch1 PE=1 SV=3
7	AFDB:P46531	0.149	0.088	7.717E-64	2555	0.256	0.124	P46531.pdb.gz	NOTC1_HUMAN Neurogenic locus notch homolog protein 1 OS=Homo sapiens OX=9606 GN=NOTCH1 PE=1 SV=4
8	AFDB:Q8UWJ4	0.246	0.414	3.266E-62	717	0.177	0.305	Q8UWJ4.pdb.gz	DLLD_DANRE Delta-like protein D OS=Danio rerio OX=7955 GN=dld PE=1 SV=2
9	AFDB:Q99466	0.101	0.070	4.302E-62	2003	0.290	0.179	Q99466.pdb.gz	NOTC4_HUMAN Neurogenic locus notch homolog protein 4 OS=Homo sapiens OX=9606 GN=NOTCH4 PE=1 SV=2
10	AFDB:O00548	0.240	0.399	6.050E-61	723	0.191	0.328	O00548.pdb.gz	DLL1_HUMAN Delta-like protein 1 OS=Homo sapiens OX=9606 GN=DLL1 PE=1 SV=2
11	PDB:7q3nU	0.051	0.156	1.425E-5	292	0.034	0.144	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
12	PDB:5ixcA	0.076	0.131	4.786E-5	684	0.018	0.032	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
13	PDB:1cjyA	0.086	0.160	6.303E-5	633	0.015	0.028	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
14	PDB:5izrC	0.081	0.145	1.290E-4	659	0.016	0.030	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
15	PDB:5iz5B	0.087	0.139	1.363E-4	746	0.016	0.027	5iz5B.pdb.gz
16	PDB:3nsjA	0.086	0.181	1.608E-4	530	0.017	0.040	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
17	PDB:5iz5A	0.084	0.133	2.237E-4	757	0.017	0.028	5iz5A.pdb.gz
18	PDB:5a50A	0.080	0.496	5.401E-4	165	0.016	0.121	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
19	PDB:4rj9A	0.081	0.504	1.456E-3	161	0.015	0.112	4rj9A.pdb.gz
20	PDB:3pfqA	0.062	0.136	1.917E-3	523	0.015	0.036	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P18168	0.0	603	1404	0.349	0.308	SERR_DROME Protein serrate OS=Drosophila melanogaster OX=7227 GN=Ser PE=1 SV=3
2	P78504	0.0	1293	1218	0.529	0.538	JAG1_HUMAN Protein jagged-1 OS=Homo sapiens OX=9606 GN=JAG1 PE=1 SV=3
3	P97607	0.0	2024	1202	0.858	0.884	JAG2_RAT Protein jagged-2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Jag2 PE=2 SV=1
4	Q5TZK7	0.0	1166	1216	0.500	0.509	Q5TZK7_DANRE Delta-like protein OS=Danio rerio OX=7955 GN=jag2 PE=4 SV=1
5	Q63722	0.0	1283	1219	0.520	0.528	JAG1_RAT Protein jagged-1 OS=Rattus norvegicus OX=10116 GN=Jag1 PE=1 SV=2
6	Q90Y54	0.0	1275	1213	0.513	0.523	JAG1B_DANRE Protein jagged-1b OS=Danio rerio OX=7955 GN=jag1b PE=2 SV=1
7	Q90Y56	0.0	1414	1254	0.573	0.565	Q90Y56_DANRE Delta-like protein OS=Danio rerio OX=7955 GN=jag2 PE=2 SV=1
8	Q90Y57	0.0	1241	1242	0.495	0.494	JAG1A_DANRE Protein jagged-1a OS=Danio rerio OX=7955 GN=jag1a PE=2 SV=1
9	Q9QXX0	0.0	1283	1218	0.521	0.530	JAG1_MOUSE Protein jagged-1 OS=Mus musculus OX=10090 GN=Jag1 PE=1 SV=1
10	Q9QYE5	0.0	2123	1247	0.905	0.899	JAG2_MOUSE Protein jagged-2 OS=Mus musculus OX=10090 GN=Jag2 PE=2 SV=2
11	Q9Y219	0.0	2502	1238	1.000	1.000	JAG2_HUMAN Protein jagged-2 OS=Homo sapiens OX=9606 GN=JAG2 PE=1 SV=3
12	Q90656	3.08e-129	416	728	0.181	0.308	Q90656_CHICK Delta-like protein OS=Gallus gallus OX=9031 PE=2 SV=1
13	O00548	3.93e-128	412	723	0.181	0.310	DLL1_HUMAN Delta-like protein 1 OS=Homo sapiens OX=9606 GN=DLL1 PE=1 SV=2
14	P10041	4.46e-128	416	833	0.189	0.281	DL_DROME Neurogenic locus protein delta OS=Drosophila melanogaster OX=7227 GN=Delta PE=1 SV=2
15	Q61483	9.72e-128	412	722	0.183	0.314	DLL1_MOUSE Delta-like protein 1 OS=Mus musculus OX=10090 GN=Dll1 PE=1 SV=2
16	P97677	4.43e-127	409	714	0.184	0.319	DLL1_RAT Delta-like protein 1 OS=Rattus norvegicus OX=10116 GN=Dll1 PE=1 SV=1
17	Q9NR61	6.94e-124	400	685	0.180	0.326	DLL4_HUMAN Delta-like protein 4 OS=Homo sapiens OX=9606 GN=DLL4 PE=1 SV=1
18	Q6DI48	7.01e-124	403	772	0.177	0.284	DLLA_DANRE Delta-like protein A OS=Danio rerio OX=7955 GN=dla PE=1 SV=1
19	P07207	1.17e-123	425	2703	0.204	0.093	NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster OX=7227 GN=N PE=1 SV=3
20	Q8UWJ4	9.74e-123	398	717	0.167	0.289	DLLD_DANRE Delta-like protein D OS=Danio rerio OX=7955 GN=dld PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01414 DSL	5.1e-16	70.0	Delta serrate ligand
2	PF00008 EGF	2.1e-72	250.2	EGF-like domain
3	PF07974 EGF_2	3e-17	74.0	EGF-like domain
4	PF12947 EGF_3	35	16.0	EGF domain
5	PF07645 EGF_CA	1.3e-10	52.6	Calcium-binding EGF domain
6	PF12661 hEGF	1.3e-37	138.3	Human growth factor-like EGF
7	PF07657 MNNL	4.2e-52	187.2	N terminus of Notch ligand C2-like domain
8	PF07123 PsbW	5.9e+02	11.9	Photosystem II reaction centre W protein (PsbW)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000328169

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000426103	0.974	E3 ubiquitin-protein ligase MIB2
2	9606.ENSP00000358815	0.971	E3 ubiquitin-protein ligase NEURL1B
3	9606.ENSP00000358795	0.969	E3 ubiquitin-protein ligase NEURL1
4	9606.ENSP00000260408	0.968	Disintegrin and metalloproteinase domain-containing protein 10
5	9606.ENSP00000263388	0.965	Neurogenic locus notch homolog protein 3
6	9606.ENSP00000277541	0.965	Neurogenic locus notch homolog protein 1
7	9606.ENSP00000256646	0.963	Neurogenic locus notch homolog protein 2
8	9606.ENSP00000261537	0.959	E3 ubiquitin-protein ligase MIB1
9	9606.ENSP00000309968	0.950	Disintegrin and metalloproteinase domain-containing protein 17
10	9606.ENSP00000345206	0.947	Recombining binding protein suppressor of hairless
11	9606.ENSP00000249749	0.944	Delta-like protein 4
12	9606.ENSP00000355718	0.944	Delta-like protein 1
13	9606.ENSP00000254958	0.939	Protein jagged-1
14	9606.ENSP00000364163	0.879	Neurogenic locus notch homolog protein 4
15	9606.ENSP00000319104	0.851	Transcription elongation factor SPT6
16	9606.ENSP00000384949	0.841	Pyrroline-5-carboxylate reductase 1, mitochondrial
17	9606.ENSP00000338272	0.824	Hairy/enhancer-of-split related with YRPW motif protein 1
18	9606.ENSP00000352069	0.785	NEDD4-like E3 ubiquitin-protein ligase WWP2
19	9606.ENSP00000362361	0.757	Cyclin-dependent kinase 9
20	9606.ENSP00000222725	0.753	Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005112	1.000	Notch binding
GO:0098772	0.466	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.994	developmental process
GO:0009987	0.987	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0048856	0.961	anatomical structure development
GO:0032501	0.959	multicellular organismal process
GO:0030154	0.958	cell differentiation
GO:0048731	0.926	system development
GO:0050896	0.866	response to stimulus
GO:0048513	0.836	animal organ development
GO:0048518	0.825	positive regulation of biological process
GO:0048522	0.791	positive regulation of cellular process
GO:0048519	0.763	negative regulation of biological process
GO:0019222	0.756	regulation of metabolic process
GO:0060255	0.735	regulation of macromolecule metabolic process
GO:0048523	0.715	negative regulation of cellular process
GO:0000003	0.704	reproduction
GO:0048468	0.609	cell development
GO:0022414	0.589	reproductive process
GO:0002376	0.565	immune system process
GO:0003006	0.548	developmental process involved in reproduction
GO:0051716	0.545	cellular response to stimulus
GO:0048609	0.540	multicellular organismal reproductive process
GO:0019953	0.537	sexual reproduction
GO:0010468	0.528	regulation of gene expression
GO:0007276	0.517	gamete generation
GO:0007165	0.516	signal transduction
GO:0048232	0.499	male gamete generation
GO:0030097	0.486	hemopoiesis
GO:0080090	0.458	regulation of primary metabolic process
GO:0051171	0.458	regulation of nitrogen compound metabolic process
GO:0002521	0.443	leukocyte differentiation
GO:0048583	0.424	regulation of response to stimulus
GO:0007166	0.412	cell surface receptor signaling pathway
GO:0023051	0.409	regulation of signaling
GO:0010646	0.408	regulation of cell communication
GO:0009966	0.404	regulation of signal transduction
GO:0046649	0.401	lymphocyte activation
GO:1903131	0.397	mononuclear cell differentiation
GO:0031323	0.380	regulation of cellular metabolic process
GO:0009889	0.354	regulation of biosynthetic process
GO:0010604	0.338	positive regulation of macromolecule metabolic process
GO:0030098	0.332	lymphocyte differentiation
GO:0019219	0.328	regulation of nucleobase-containing compound metabolic process
GO:0050793	0.326	regulation of developmental process
GO:0051252	0.313	regulation of RNA metabolic process
GO:0010556	0.312	regulation of macromolecule biosynthetic process
GO:0031326	0.312	regulation of cellular biosynthetic process
GO:0042110	0.301	T cell activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0005622	0.975	intracellular anatomical structure
GO:0005737	0.959	cytoplasm
GO:0043227	0.688	membrane-bounded organelle
GO:0043231	0.368	intracellular membrane-bounded organelle
GO:0031981	0.359	nuclear lumen
GO:0005654	0.337	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]